Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JNH9

Protein Details
Accession C4JNH9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
302-326TNFVRLPKESKKDRAQRGAKRQGGFHydrophilic
NLS Segment(s)
PositionSequence
309-323KESKKDRAQRGAKRQ
342-370ERLTRRNKGAGGALEKSRKRRLTEDGPRG
377-391EGFEKRRKKVAGWKK
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, mito 4, extr 1, pero 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
KEGG ure:UREG_02977  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MASLEQQSNAHSSLSLALETLTDSVSGALAALPHDQPHHDASDKSSVLAPADGISLLDTKNEVLLSYLQTLAFFLLLQVRRLNAQPLQRASGLSQDVTTQEQEVVNRLVELRSYLERGVKPLENRLKYQVDKILKAADDAERTQRIAAGKKETKRKDIAGGSDTDSSTGSKMSGASSDEDETEEDEDIDELAYRPNLAALSKGTKDTENPATSTKSTPGDGVYRPPKIKPTALPMEASDRRSDREPRRPAKSRVIDEFVSAEMSVAPMAEPSIGSTIRAGGREVRTQRQREIEAERRSYEETNFVRLPKESKKDRAQRGAKRQGGFGGEDWRSLGEGADRIERLTRRNKGAGGALEKSRKRRLTEDGPRGDGVSIGEGFEKRRKKVAGWKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.11
5 0.11
6 0.11
7 0.11
8 0.08
9 0.06
10 0.07
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.07
18 0.09
19 0.1
20 0.11
21 0.13
22 0.14
23 0.16
24 0.19
25 0.22
26 0.22
27 0.22
28 0.26
29 0.33
30 0.32
31 0.3
32 0.29
33 0.26
34 0.25
35 0.24
36 0.2
37 0.11
38 0.12
39 0.11
40 0.08
41 0.08
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.08
51 0.1
52 0.12
53 0.13
54 0.14
55 0.13
56 0.13
57 0.13
58 0.12
59 0.1
60 0.07
61 0.06
62 0.12
63 0.13
64 0.15
65 0.16
66 0.17
67 0.18
68 0.2
69 0.24
70 0.22
71 0.27
72 0.32
73 0.34
74 0.37
75 0.36
76 0.35
77 0.32
78 0.33
79 0.27
80 0.21
81 0.18
82 0.16
83 0.16
84 0.17
85 0.17
86 0.12
87 0.12
88 0.13
89 0.13
90 0.15
91 0.15
92 0.13
93 0.13
94 0.13
95 0.11
96 0.1
97 0.11
98 0.11
99 0.12
100 0.13
101 0.14
102 0.19
103 0.19
104 0.22
105 0.25
106 0.26
107 0.25
108 0.33
109 0.41
110 0.38
111 0.4
112 0.44
113 0.46
114 0.43
115 0.46
116 0.44
117 0.39
118 0.38
119 0.37
120 0.34
121 0.28
122 0.27
123 0.25
124 0.2
125 0.18
126 0.18
127 0.22
128 0.19
129 0.19
130 0.19
131 0.19
132 0.19
133 0.21
134 0.24
135 0.28
136 0.34
137 0.39
138 0.49
139 0.51
140 0.54
141 0.53
142 0.51
143 0.49
144 0.46
145 0.44
146 0.37
147 0.35
148 0.31
149 0.29
150 0.27
151 0.2
152 0.17
153 0.13
154 0.11
155 0.1
156 0.07
157 0.06
158 0.06
159 0.06
160 0.07
161 0.08
162 0.09
163 0.1
164 0.1
165 0.1
166 0.1
167 0.1
168 0.09
169 0.09
170 0.08
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.1
188 0.11
189 0.12
190 0.12
191 0.12
192 0.13
193 0.17
194 0.22
195 0.2
196 0.2
197 0.21
198 0.23
199 0.24
200 0.24
201 0.22
202 0.17
203 0.17
204 0.16
205 0.16
206 0.17
207 0.16
208 0.22
209 0.24
210 0.28
211 0.29
212 0.29
213 0.33
214 0.33
215 0.35
216 0.31
217 0.34
218 0.36
219 0.36
220 0.36
221 0.32
222 0.37
223 0.36
224 0.35
225 0.3
226 0.24
227 0.25
228 0.28
229 0.37
230 0.37
231 0.44
232 0.53
233 0.57
234 0.66
235 0.72
236 0.74
237 0.75
238 0.75
239 0.7
240 0.65
241 0.63
242 0.53
243 0.46
244 0.41
245 0.31
246 0.23
247 0.17
248 0.12
249 0.07
250 0.07
251 0.06
252 0.05
253 0.04
254 0.03
255 0.04
256 0.04
257 0.04
258 0.04
259 0.07
260 0.07
261 0.07
262 0.08
263 0.11
264 0.12
265 0.13
266 0.13
267 0.16
268 0.2
269 0.27
270 0.31
271 0.37
272 0.44
273 0.47
274 0.51
275 0.52
276 0.51
277 0.49
278 0.54
279 0.54
280 0.53
281 0.54
282 0.5
283 0.46
284 0.46
285 0.43
286 0.35
287 0.35
288 0.29
289 0.31
290 0.32
291 0.31
292 0.3
293 0.3
294 0.34
295 0.34
296 0.42
297 0.43
298 0.5
299 0.6
300 0.67
301 0.75
302 0.8
303 0.82
304 0.83
305 0.86
306 0.88
307 0.84
308 0.76
309 0.68
310 0.61
311 0.54
312 0.46
313 0.37
314 0.34
315 0.27
316 0.26
317 0.25
318 0.21
319 0.19
320 0.17
321 0.15
322 0.1
323 0.12
324 0.13
325 0.17
326 0.17
327 0.17
328 0.23
329 0.25
330 0.29
331 0.36
332 0.42
333 0.44
334 0.49
335 0.5
336 0.48
337 0.52
338 0.52
339 0.48
340 0.45
341 0.45
342 0.49
343 0.52
344 0.56
345 0.59
346 0.58
347 0.57
348 0.59
349 0.62
350 0.64
351 0.71
352 0.74
353 0.72
354 0.7
355 0.65
356 0.6
357 0.51
358 0.41
359 0.3
360 0.23
361 0.17
362 0.13
363 0.15
364 0.15
365 0.2
366 0.27
367 0.33
368 0.33
369 0.4
370 0.43
371 0.48