Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094ANX1

Protein Details
Accession A0A094ANX1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-43VPDIKLKDAPVRKKRRKAPPPAPLLPPHydrophilic
NLS Segment(s)
PositionSequence
23-48KDAPVRKKRRKAPPPAPLLPPPAPRL
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MYPDCYETDEDSAMKAVPDIKLKDAPVRKKRRKAPPPAPLLPPPAPRLRPAEDPRLVPLPPSPLMPTQDVEGPPRVPLRLSPVLMPTQDMENPRLIPLPPVPNWMIPRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.13
5 0.19
6 0.2
7 0.23
8 0.26
9 0.27
10 0.35
11 0.41
12 0.48
13 0.53
14 0.62
15 0.69
16 0.75
17 0.83
18 0.86
19 0.88
20 0.89
21 0.89
22 0.87
23 0.86
24 0.8
25 0.76
26 0.67
27 0.64
28 0.57
29 0.49
30 0.44
31 0.4
32 0.37
33 0.34
34 0.36
35 0.33
36 0.38
37 0.39
38 0.44
39 0.4
40 0.4
41 0.4
42 0.37
43 0.33
44 0.24
45 0.21
46 0.17
47 0.15
48 0.15
49 0.15
50 0.15
51 0.17
52 0.18
53 0.18
54 0.15
55 0.18
56 0.17
57 0.18
58 0.18
59 0.16
60 0.17
61 0.17
62 0.17
63 0.14
64 0.14
65 0.2
66 0.23
67 0.23
68 0.23
69 0.25
70 0.27
71 0.27
72 0.27
73 0.2
74 0.17
75 0.2
76 0.2
77 0.2
78 0.2
79 0.21
80 0.21
81 0.22
82 0.19
83 0.2
84 0.24
85 0.29
86 0.27
87 0.32
88 0.33
89 0.37
90 0.41