Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A5Y3

Protein Details
Accession A0A094A5Y3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-53ILPLHGRDRHLRPKQHQHPRGHKRHRSQPIPRHRRPPRRKRRALPPPSLPABasic
NLS Segment(s)
PositionSequence
10-47DRHLRPKQHQHPRGHKRHRSQPIPRHRRPPRRKRRALP
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MGILPLHGRDRHLRPKQHQHPRGHKRHRSQPIPRHRRPPRRKRRALPPPSLPAATPSYRLASAIPLPPSPVYRRVPGAVDAEPLPRARLRGGHLLLLRWHRVRRLRHPRAFLKDAITASPAADCEFHILRPAALSPGSMSTTPTPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.83
4 0.87
5 0.87
6 0.87
7 0.89
8 0.9
9 0.92
10 0.91
11 0.9
12 0.88
13 0.9
14 0.9
15 0.89
16 0.89
17 0.88
18 0.88
19 0.89
20 0.87
21 0.87
22 0.88
23 0.89
24 0.89
25 0.9
26 0.9
27 0.91
28 0.94
29 0.92
30 0.93
31 0.92
32 0.91
33 0.88
34 0.84
35 0.78
36 0.71
37 0.63
38 0.51
39 0.43
40 0.38
41 0.3
42 0.25
43 0.2
44 0.18
45 0.18
46 0.18
47 0.15
48 0.13
49 0.14
50 0.15
51 0.15
52 0.13
53 0.15
54 0.15
55 0.17
56 0.17
57 0.21
58 0.2
59 0.2
60 0.22
61 0.22
62 0.22
63 0.23
64 0.23
65 0.17
66 0.16
67 0.15
68 0.14
69 0.14
70 0.13
71 0.12
72 0.1
73 0.1
74 0.1
75 0.12
76 0.15
77 0.22
78 0.22
79 0.26
80 0.26
81 0.26
82 0.29
83 0.3
84 0.31
85 0.27
86 0.28
87 0.29
88 0.36
89 0.43
90 0.5
91 0.58
92 0.65
93 0.69
94 0.76
95 0.78
96 0.79
97 0.76
98 0.66
99 0.59
100 0.53
101 0.46
102 0.38
103 0.31
104 0.23
105 0.19
106 0.17
107 0.14
108 0.1
109 0.09
110 0.09
111 0.12
112 0.13
113 0.13
114 0.17
115 0.17
116 0.16
117 0.17
118 0.18
119 0.15
120 0.14
121 0.15
122 0.11
123 0.14
124 0.16
125 0.15
126 0.17
127 0.19