Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A2B2

Protein Details
Accession A0A094A2B2    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
281-304DHVIERRRKKVEGKEKKNLPYARRBasic
NLS Segment(s)
PositionSequence
94-108SGKGKSEKEIKRPKK
122-127RKAGRK
206-235KDEHEKEKLKRTLHSLESKVKAATRKAKET
240-243KHRK
286-298RRRKKVEGKEKKN
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MSSIKRKALGSSLQRRVRARRDASEEPQELSESSDQDDGVSGSEDGVDENSANNNESDDSGDAEDSESEDSEPGEAASISFGALAKAQESIQRSGKGKSEKEIKRPKKVSDDPWENNEAAERKAGRKDHRDFSRSNKNAPTEISSKKAVSRKRDVVPVVKRDYRDPRFDPSVGQVDDTKVNKAYSFLNDYRQDEVKALKEQIKKTKDEHEKEKLKRTLHSLESKVKAATRKAKETEILDKHRKEEKQLVKEGKTPFYLKKAEQKKQFIMEQYSSLKGKQLDHVIERRRKKVEGKEKKNLPYARRDFGGDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.74
4 0.74
5 0.74
6 0.7
7 0.69
8 0.71
9 0.73
10 0.73
11 0.74
12 0.67
13 0.58
14 0.52
15 0.45
16 0.36
17 0.32
18 0.27
19 0.18
20 0.18
21 0.17
22 0.16
23 0.15
24 0.16
25 0.12
26 0.1
27 0.1
28 0.08
29 0.07
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13
45 0.11
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.11
76 0.14
77 0.18
78 0.21
79 0.26
80 0.27
81 0.29
82 0.35
83 0.39
84 0.37
85 0.4
86 0.46
87 0.47
88 0.56
89 0.64
90 0.66
91 0.7
92 0.73
93 0.72
94 0.72
95 0.73
96 0.71
97 0.71
98 0.72
99 0.65
100 0.64
101 0.61
102 0.51
103 0.44
104 0.38
105 0.29
106 0.2
107 0.2
108 0.17
109 0.17
110 0.22
111 0.28
112 0.31
113 0.39
114 0.44
115 0.5
116 0.55
117 0.56
118 0.53
119 0.56
120 0.61
121 0.54
122 0.52
123 0.48
124 0.42
125 0.4
126 0.39
127 0.36
128 0.29
129 0.29
130 0.29
131 0.26
132 0.24
133 0.28
134 0.32
135 0.33
136 0.35
137 0.41
138 0.44
139 0.45
140 0.5
141 0.47
142 0.5
143 0.51
144 0.5
145 0.48
146 0.44
147 0.42
148 0.43
149 0.5
150 0.46
151 0.46
152 0.42
153 0.42
154 0.44
155 0.43
156 0.39
157 0.33
158 0.34
159 0.27
160 0.26
161 0.21
162 0.18
163 0.22
164 0.22
165 0.2
166 0.15
167 0.16
168 0.15
169 0.15
170 0.16
171 0.14
172 0.2
173 0.2
174 0.25
175 0.29
176 0.3
177 0.32
178 0.32
179 0.3
180 0.24
181 0.25
182 0.22
183 0.21
184 0.22
185 0.26
186 0.31
187 0.36
188 0.44
189 0.46
190 0.45
191 0.45
192 0.53
193 0.56
194 0.57
195 0.6
196 0.61
197 0.66
198 0.69
199 0.76
200 0.71
201 0.64
202 0.6
203 0.58
204 0.55
205 0.53
206 0.55
207 0.5
208 0.52
209 0.53
210 0.52
211 0.46
212 0.42
213 0.4
214 0.4
215 0.44
216 0.43
217 0.47
218 0.49
219 0.5
220 0.51
221 0.51
222 0.53
223 0.52
224 0.54
225 0.55
226 0.54
227 0.56
228 0.59
229 0.57
230 0.53
231 0.55
232 0.56
233 0.56
234 0.63
235 0.66
236 0.62
237 0.67
238 0.64
239 0.58
240 0.53
241 0.48
242 0.43
243 0.43
244 0.44
245 0.42
246 0.48
247 0.54
248 0.58
249 0.64
250 0.68
251 0.67
252 0.68
253 0.68
254 0.65
255 0.61
256 0.55
257 0.5
258 0.46
259 0.44
260 0.4
261 0.35
262 0.34
263 0.3
264 0.3
265 0.31
266 0.36
267 0.36
268 0.42
269 0.51
270 0.56
271 0.62
272 0.67
273 0.69
274 0.67
275 0.67
276 0.69
277 0.71
278 0.73
279 0.75
280 0.77
281 0.8
282 0.84
283 0.86
284 0.86
285 0.83
286 0.78
287 0.77
288 0.74
289 0.7
290 0.63