Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JEU0

Protein Details
Accession C4JEU0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
195-216TYKRTPLDPAPRGKRRKMEEKKBasic
NLS Segment(s)
PositionSequence
204-216APRGKRRKMEEKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
KEGG ure:UREG_02250  -  
Amino Acid Sequences MPSSPTKPTLAPLDTSKALVFPSEFHDSPLFSAKFEMLKHEDALKTPITPPVAYTDLLKTLTPMVATPLSSSTLSTDKSSNPSTGTSPYFCNCEQHPRSLTIPLKTPGSAATTKSQPERSQRTPRTPLNLRPLRISASAKGSPITESPRSASLRSILSPAGEWPVDAKVRYLDASRCSSCARPVTVRQVVTRTITYKRTPLDPAPRGKRRKMEEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.31
4 0.24
5 0.22
6 0.2
7 0.16
8 0.12
9 0.17
10 0.22
11 0.22
12 0.24
13 0.25
14 0.24
15 0.26
16 0.33
17 0.27
18 0.21
19 0.22
20 0.21
21 0.22
22 0.22
23 0.26
24 0.22
25 0.24
26 0.25
27 0.28
28 0.28
29 0.26
30 0.29
31 0.23
32 0.21
33 0.2
34 0.22
35 0.2
36 0.19
37 0.18
38 0.2
39 0.21
40 0.2
41 0.2
42 0.18
43 0.18
44 0.19
45 0.18
46 0.14
47 0.13
48 0.13
49 0.12
50 0.1
51 0.11
52 0.1
53 0.11
54 0.11
55 0.11
56 0.12
57 0.12
58 0.12
59 0.11
60 0.13
61 0.14
62 0.14
63 0.15
64 0.14
65 0.19
66 0.2
67 0.19
68 0.18
69 0.19
70 0.19
71 0.21
72 0.21
73 0.18
74 0.19
75 0.18
76 0.21
77 0.19
78 0.2
79 0.18
80 0.26
81 0.27
82 0.3
83 0.31
84 0.3
85 0.31
86 0.36
87 0.37
88 0.29
89 0.31
90 0.27
91 0.26
92 0.23
93 0.22
94 0.16
95 0.16
96 0.16
97 0.14
98 0.15
99 0.17
100 0.18
101 0.21
102 0.24
103 0.24
104 0.31
105 0.37
106 0.42
107 0.5
108 0.55
109 0.6
110 0.64
111 0.63
112 0.64
113 0.61
114 0.6
115 0.6
116 0.6
117 0.53
118 0.48
119 0.46
120 0.41
121 0.39
122 0.34
123 0.26
124 0.26
125 0.27
126 0.24
127 0.24
128 0.21
129 0.19
130 0.19
131 0.22
132 0.18
133 0.18
134 0.19
135 0.24
136 0.26
137 0.25
138 0.24
139 0.22
140 0.22
141 0.21
142 0.21
143 0.16
144 0.15
145 0.14
146 0.14
147 0.14
148 0.11
149 0.1
150 0.1
151 0.13
152 0.15
153 0.14
154 0.15
155 0.13
156 0.15
157 0.16
158 0.18
159 0.18
160 0.21
161 0.28
162 0.28
163 0.28
164 0.3
165 0.31
166 0.33
167 0.34
168 0.34
169 0.34
170 0.39
171 0.46
172 0.5
173 0.51
174 0.48
175 0.47
176 0.45
177 0.43
178 0.4
179 0.34
180 0.33
181 0.37
182 0.37
183 0.4
184 0.4
185 0.41
186 0.43
187 0.48
188 0.54
189 0.55
190 0.63
191 0.67
192 0.74
193 0.77
194 0.8
195 0.8
196 0.79