Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JDE0

Protein Details
Accession C4JDE0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-77LSRPATKVCRCRRQLHKYPGSLQKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
KEGG ure:UREG_00306  -  
Amino Acid Sequences MCIIDRLRGELRTDGQNSPLRLFKTGHHSMDDHDAARVNVSSSDSSEFSYGNLSRPATKVCRCRRQLHKYPGSLQKTVGLFRAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.38
4 0.37
5 0.35
6 0.36
7 0.3
8 0.3
9 0.3
10 0.27
11 0.3
12 0.35
13 0.34
14 0.32
15 0.31
16 0.3
17 0.35
18 0.33
19 0.24
20 0.18
21 0.18
22 0.15
23 0.15
24 0.14
25 0.08
26 0.07
27 0.08
28 0.08
29 0.08
30 0.1
31 0.1
32 0.1
33 0.1
34 0.1
35 0.08
36 0.12
37 0.12
38 0.12
39 0.14
40 0.14
41 0.15
42 0.17
43 0.21
44 0.23
45 0.29
46 0.38
47 0.45
48 0.55
49 0.59
50 0.67
51 0.74
52 0.79
53 0.83
54 0.84
55 0.83
56 0.79
57 0.81
58 0.82
59 0.77
60 0.68
61 0.58
62 0.53
63 0.47
64 0.42