Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JWB7

Protein Details
Accession C4JWB7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
111-137VLCAGKKGAKLRQKRHIPRHPHARPAEBasic
NLS Segment(s)
PositionSequence
116-136KKGAKLRQKRHIPRHPHARPA
Subcellular Location(s) cyto_nucl 13.5, nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006771  Bys1  
IPR037176  Osmotin/thaumatin-like_sf  
IPR001938  Thaumatin  
KEGG ure:UREG_06859  -  
Pfam View protein in Pfam  
PF04681  Bys1  
PROSITE View protein in PROSITE  
PS51367  THAUMATIN_2  
Amino Acid Sequences MKKLSSGDKYSEEYRKNDNGGGISIKLSLDKDQKEVSQFEYTLDDPKVFYDLSNIDGYPFKDGGVTIVPSDDSCPKVTCEAGDGKCSEAYNKPDDDHATHGCPQETDLHVVLCAGKKGAKLRQKRHIPRHPHARPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.48
4 0.45
5 0.41
6 0.34
7 0.32
8 0.3
9 0.24
10 0.19
11 0.17
12 0.15
13 0.14
14 0.13
15 0.16
16 0.21
17 0.21
18 0.24
19 0.26
20 0.28
21 0.3
22 0.3
23 0.29
24 0.26
25 0.24
26 0.22
27 0.23
28 0.22
29 0.22
30 0.21
31 0.17
32 0.14
33 0.14
34 0.14
35 0.11
36 0.1
37 0.09
38 0.09
39 0.12
40 0.13
41 0.12
42 0.11
43 0.13
44 0.14
45 0.13
46 0.13
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.06
54 0.06
55 0.07
56 0.06
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.11
63 0.12
64 0.12
65 0.11
66 0.12
67 0.17
68 0.17
69 0.18
70 0.18
71 0.18
72 0.19
73 0.19
74 0.19
75 0.17
76 0.2
77 0.21
78 0.22
79 0.22
80 0.23
81 0.25
82 0.25
83 0.25
84 0.24
85 0.24
86 0.26
87 0.28
88 0.26
89 0.23
90 0.22
91 0.23
92 0.22
93 0.22
94 0.19
95 0.17
96 0.17
97 0.17
98 0.18
99 0.14
100 0.13
101 0.11
102 0.12
103 0.15
104 0.22
105 0.3
106 0.37
107 0.46
108 0.54
109 0.64
110 0.73
111 0.81
112 0.86
113 0.87
114 0.89
115 0.89
116 0.91
117 0.88