Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JT76

Protein Details
Accession C4JT76    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-77DSGRDRRRDRTPPRRVRSPSPBasic
NLS Segment(s)
PositionSequence
60-122RDRRRDRTPPRRVRSPSPRRSGRGDYSPRKEDRRDRDYDRRDRSRSPDDRERERDRDRERDRE
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG ure:UREG_05665  -  
Amino Acid Sequences MTCYSILIYLSFAFVEYESRRDADDAYHEMHNKRIGRDDVLKIEWARTPPSASWRFDSGRDRRRDRTPPRRVRSPSPRRSGRGDYSPRKEDRRDRDYDRRDRSRSPDDRERERDRDRERDRERDRDLRDDRDRRDEDRENGTNGDDRKVPLDSPTPAHDELDTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.13
3 0.13
4 0.15
5 0.16
6 0.17
7 0.18
8 0.18
9 0.18
10 0.16
11 0.19
12 0.2
13 0.21
14 0.24
15 0.27
16 0.27
17 0.3
18 0.34
19 0.32
20 0.31
21 0.35
22 0.33
23 0.35
24 0.41
25 0.41
26 0.39
27 0.38
28 0.39
29 0.32
30 0.32
31 0.29
32 0.24
33 0.23
34 0.19
35 0.2
36 0.18
37 0.27
38 0.31
39 0.3
40 0.31
41 0.33
42 0.34
43 0.36
44 0.43
45 0.43
46 0.47
47 0.53
48 0.56
49 0.57
50 0.63
51 0.69
52 0.71
53 0.73
54 0.75
55 0.78
56 0.79
57 0.83
58 0.8
59 0.8
60 0.8
61 0.8
62 0.78
63 0.76
64 0.75
65 0.69
66 0.7
67 0.66
68 0.59
69 0.58
70 0.57
71 0.56
72 0.56
73 0.59
74 0.57
75 0.55
76 0.57
77 0.56
78 0.56
79 0.55
80 0.55
81 0.57
82 0.64
83 0.69
84 0.73
85 0.74
86 0.73
87 0.7
88 0.68
89 0.68
90 0.68
91 0.65
92 0.64
93 0.64
94 0.62
95 0.67
96 0.71
97 0.71
98 0.68
99 0.67
100 0.68
101 0.64
102 0.68
103 0.66
104 0.69
105 0.67
106 0.7
107 0.71
108 0.71
109 0.72
110 0.7
111 0.68
112 0.67
113 0.66
114 0.64
115 0.68
116 0.68
117 0.65
118 0.66
119 0.66
120 0.59
121 0.63
122 0.6
123 0.55
124 0.56
125 0.55
126 0.48
127 0.45
128 0.43
129 0.4
130 0.34
131 0.32
132 0.25
133 0.23
134 0.23
135 0.24
136 0.22
137 0.21
138 0.26
139 0.26
140 0.28
141 0.3
142 0.33
143 0.32
144 0.33
145 0.29