Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XBV8

Protein Details
Accession A0A093XBV8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-56TEGEVCPDGKRRRRKRCAPEVATDHydrophilic
NLS Segment(s)
PositionSequence
42-47KRRRRK
Subcellular Location(s) extr 14, E.R. 4, mito 3, plas 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MTSSIFVTTLLASFAVVTLPHILPCPAPRVAYTEGEVCPDGKRRRRKRCAPEVATDGLVKEGKPCTTTAVIGGGEDLEEIVGTREKRECPIPKPGGTVGKILAFTGIGGNADGAGGSRPSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.09
6 0.1
7 0.1
8 0.11
9 0.11
10 0.13
11 0.15
12 0.18
13 0.16
14 0.16
15 0.16
16 0.21
17 0.23
18 0.24
19 0.23
20 0.22
21 0.21
22 0.22
23 0.22
24 0.17
25 0.16
26 0.22
27 0.29
28 0.34
29 0.45
30 0.54
31 0.65
32 0.75
33 0.83
34 0.85
35 0.89
36 0.91
37 0.85
38 0.8
39 0.72
40 0.63
41 0.54
42 0.43
43 0.32
44 0.23
45 0.18
46 0.12
47 0.1
48 0.09
49 0.09
50 0.1
51 0.1
52 0.11
53 0.12
54 0.12
55 0.11
56 0.12
57 0.11
58 0.1
59 0.1
60 0.07
61 0.06
62 0.05
63 0.05
64 0.02
65 0.02
66 0.02
67 0.04
68 0.07
69 0.07
70 0.09
71 0.12
72 0.14
73 0.17
74 0.25
75 0.31
76 0.32
77 0.42
78 0.47
79 0.46
80 0.49
81 0.51
82 0.49
83 0.44
84 0.42
85 0.33
86 0.29
87 0.28
88 0.24
89 0.19
90 0.12
91 0.11
92 0.1
93 0.09
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.05
100 0.05
101 0.06