Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZMK9

Protein Details
Accession A0A093ZMK9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-71PKGPRTCCQTRPPKRLRKPPSHVCLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MRSRISTVNFTLDLHLAISSPLQLPSHPLFRKASRDPTTFAHRHGPKGPRTCCQTRPPKRLRKPPSHVCLSRRKDDDHAWFLAHQLRHWHLGAVLPDLRPVPVAPAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.09
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.14
12 0.17
13 0.26
14 0.26
15 0.28
16 0.31
17 0.35
18 0.42
19 0.42
20 0.49
21 0.47
22 0.48
23 0.48
24 0.48
25 0.52
26 0.46
27 0.43
28 0.43
29 0.38
30 0.39
31 0.44
32 0.45
33 0.44
34 0.52
35 0.52
36 0.48
37 0.52
38 0.53
39 0.52
40 0.55
41 0.59
42 0.6
43 0.68
44 0.72
45 0.76
46 0.81
47 0.86
48 0.86
49 0.86
50 0.85
51 0.84
52 0.81
53 0.79
54 0.75
55 0.71
56 0.72
57 0.67
58 0.66
59 0.59
60 0.55
61 0.51
62 0.53
63 0.55
64 0.48
65 0.44
66 0.38
67 0.34
68 0.33
69 0.34
70 0.28
71 0.21
72 0.23
73 0.24
74 0.26
75 0.27
76 0.26
77 0.2
78 0.24
79 0.24
80 0.23
81 0.23
82 0.19
83 0.21
84 0.2
85 0.2
86 0.17
87 0.15
88 0.14