Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YQ73

Protein Details
Accession A0A093YQ73    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-60STTSHARSKPFKKSALRHSIAHydrophilic
303-323ISLDKKAQRKAQRQQKKIIAQHydrophilic
NLS Segment(s)
PositionSequence
99-110SGKRAGQLKKKP
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15458  NTR2  
Amino Acid Sequences MSSFGGKRKARKILVNEDDDETTTSPASIEPKATAEQKPSTTSHARSKPFKKSALRHSIAFDDEQSQDTSGTDGGSEPKPIREVDFGSSGSGSVPSRPSGKRAGQLKKKPAASRLSFGPGEIISGDDAAALEEEETFTPKKAAPRRGIEGNTMRLSLPAYQRGREGEEEERPTYSKDYLEELKMSTLSTPKDLQEFPAKDEEEEGLDASELEGATVVEPNGELLSRRDEDKAYIPTEAEIAEKKQRRARLAQEQDFISLDDGGDRSQISQISMLPTRKKETRLVRDDEDVMEGFEDFVDDGRISLDKKAQRKAQRQQKKIIAQAIQEAEGSSSEESDDSEAERRAEYEAAQTRAGMDGLKKHDTMQAAALVPPKVTPIPSLSECLARLRTSLSEAEQESTKRSWRMGELVREKAEIIAREQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.68
4 0.61
5 0.56
6 0.48
7 0.42
8 0.31
9 0.24
10 0.18
11 0.15
12 0.12
13 0.13
14 0.15
15 0.15
16 0.16
17 0.16
18 0.19
19 0.23
20 0.28
21 0.29
22 0.32
23 0.36
24 0.37
25 0.4
26 0.38
27 0.42
28 0.44
29 0.46
30 0.5
31 0.53
32 0.58
33 0.63
34 0.7
35 0.73
36 0.74
37 0.77
38 0.77
39 0.77
40 0.81
41 0.82
42 0.77
43 0.68
44 0.64
45 0.59
46 0.51
47 0.43
48 0.34
49 0.27
50 0.24
51 0.23
52 0.21
53 0.18
54 0.16
55 0.15
56 0.14
57 0.11
58 0.09
59 0.08
60 0.08
61 0.11
62 0.12
63 0.16
64 0.16
65 0.17
66 0.2
67 0.2
68 0.22
69 0.22
70 0.23
71 0.23
72 0.25
73 0.24
74 0.23
75 0.22
76 0.19
77 0.16
78 0.15
79 0.12
80 0.12
81 0.13
82 0.14
83 0.2
84 0.21
85 0.24
86 0.3
87 0.34
88 0.39
89 0.47
90 0.55
91 0.6
92 0.68
93 0.74
94 0.73
95 0.76
96 0.72
97 0.7
98 0.69
99 0.62
100 0.56
101 0.5
102 0.48
103 0.41
104 0.37
105 0.32
106 0.22
107 0.19
108 0.16
109 0.13
110 0.07
111 0.07
112 0.07
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.07
123 0.08
124 0.08
125 0.09
126 0.12
127 0.19
128 0.27
129 0.35
130 0.4
131 0.45
132 0.5
133 0.55
134 0.55
135 0.54
136 0.51
137 0.48
138 0.41
139 0.36
140 0.31
141 0.25
142 0.24
143 0.21
144 0.2
145 0.23
146 0.24
147 0.24
148 0.25
149 0.26
150 0.28
151 0.25
152 0.26
153 0.21
154 0.25
155 0.28
156 0.27
157 0.27
158 0.25
159 0.24
160 0.23
161 0.2
162 0.15
163 0.13
164 0.16
165 0.17
166 0.18
167 0.18
168 0.16
169 0.16
170 0.15
171 0.14
172 0.11
173 0.12
174 0.11
175 0.12
176 0.13
177 0.13
178 0.16
179 0.16
180 0.18
181 0.24
182 0.24
183 0.24
184 0.28
185 0.27
186 0.24
187 0.25
188 0.23
189 0.14
190 0.14
191 0.12
192 0.06
193 0.06
194 0.06
195 0.05
196 0.05
197 0.04
198 0.03
199 0.03
200 0.03
201 0.03
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.05
211 0.09
212 0.1
213 0.11
214 0.12
215 0.13
216 0.15
217 0.18
218 0.21
219 0.18
220 0.18
221 0.17
222 0.15
223 0.15
224 0.14
225 0.11
226 0.08
227 0.1
228 0.17
229 0.21
230 0.25
231 0.29
232 0.33
233 0.37
234 0.42
235 0.47
236 0.51
237 0.57
238 0.57
239 0.56
240 0.52
241 0.49
242 0.43
243 0.35
244 0.25
245 0.15
246 0.1
247 0.07
248 0.07
249 0.06
250 0.06
251 0.06
252 0.06
253 0.07
254 0.08
255 0.08
256 0.09
257 0.1
258 0.13
259 0.18
260 0.21
261 0.23
262 0.26
263 0.3
264 0.33
265 0.36
266 0.41
267 0.47
268 0.53
269 0.57
270 0.6
271 0.57
272 0.57
273 0.54
274 0.47
275 0.38
276 0.28
277 0.2
278 0.15
279 0.11
280 0.08
281 0.07
282 0.06
283 0.04
284 0.04
285 0.05
286 0.05
287 0.05
288 0.06
289 0.07
290 0.08
291 0.1
292 0.16
293 0.21
294 0.27
295 0.34
296 0.42
297 0.51
298 0.6
299 0.68
300 0.73
301 0.78
302 0.79
303 0.81
304 0.82
305 0.79
306 0.75
307 0.72
308 0.65
309 0.55
310 0.55
311 0.47
312 0.38
313 0.31
314 0.25
315 0.18
316 0.15
317 0.15
318 0.09
319 0.07
320 0.07
321 0.07
322 0.07
323 0.08
324 0.08
325 0.08
326 0.12
327 0.13
328 0.14
329 0.14
330 0.14
331 0.15
332 0.16
333 0.15
334 0.2
335 0.25
336 0.26
337 0.26
338 0.26
339 0.24
340 0.24
341 0.24
342 0.17
343 0.13
344 0.17
345 0.22
346 0.26
347 0.25
348 0.26
349 0.3
350 0.3
351 0.29
352 0.25
353 0.24
354 0.22
355 0.24
356 0.26
357 0.23
358 0.21
359 0.19
360 0.2
361 0.17
362 0.16
363 0.17
364 0.16
365 0.22
366 0.24
367 0.27
368 0.26
369 0.28
370 0.28
371 0.31
372 0.31
373 0.25
374 0.24
375 0.23
376 0.23
377 0.23
378 0.25
379 0.23
380 0.25
381 0.26
382 0.28
383 0.29
384 0.29
385 0.29
386 0.3
387 0.33
388 0.3
389 0.3
390 0.32
391 0.33
392 0.41
393 0.44
394 0.52
395 0.54
396 0.59
397 0.59
398 0.55
399 0.51
400 0.46
401 0.43
402 0.34