Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XRR4

Protein Details
Accession A0A093XRR4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-135VRLIKANRDPVRRRRRRLLLPKHNAIAHydrophilic
NLS Segment(s)
PositionSequence
116-126RDPVRRRRRRL
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MPSRDPTLIPNTVPRIRLARPLPVPLALINARIQTPPMLLQTRQEPQKQQPRAHSLHPTRYPRISIDLKLIRPQRPILPHLLLQQPHRLQHLPHRSRQHIIRANQTQAVRLIKANRDPVRRRRRRLLLPKHNAIAVEVRENLAHHDTGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.36
4 0.44
5 0.4
6 0.41
7 0.41
8 0.44
9 0.43
10 0.38
11 0.37
12 0.28
13 0.31
14 0.22
15 0.21
16 0.18
17 0.17
18 0.17
19 0.16
20 0.17
21 0.12
22 0.13
23 0.13
24 0.16
25 0.18
26 0.17
27 0.2
28 0.25
29 0.3
30 0.34
31 0.36
32 0.36
33 0.42
34 0.52
35 0.56
36 0.56
37 0.57
38 0.6
39 0.59
40 0.59
41 0.6
42 0.55
43 0.57
44 0.6
45 0.58
46 0.54
47 0.53
48 0.5
49 0.41
50 0.42
51 0.35
52 0.28
53 0.31
54 0.31
55 0.3
56 0.35
57 0.39
58 0.35
59 0.34
60 0.34
61 0.31
62 0.3
63 0.31
64 0.29
65 0.26
66 0.26
67 0.27
68 0.3
69 0.27
70 0.25
71 0.31
72 0.28
73 0.27
74 0.29
75 0.26
76 0.23
77 0.31
78 0.41
79 0.38
80 0.43
81 0.49
82 0.49
83 0.53
84 0.56
85 0.57
86 0.53
87 0.53
88 0.55
89 0.53
90 0.52
91 0.52
92 0.48
93 0.4
94 0.36
95 0.35
96 0.26
97 0.24
98 0.27
99 0.27
100 0.32
101 0.4
102 0.42
103 0.5
104 0.57
105 0.65
106 0.72
107 0.77
108 0.8
109 0.81
110 0.84
111 0.86
112 0.89
113 0.89
114 0.89
115 0.89
116 0.87
117 0.79
118 0.71
119 0.6
120 0.51
121 0.45
122 0.36
123 0.31
124 0.24
125 0.23
126 0.22
127 0.22
128 0.24
129 0.21
130 0.19