Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CMS6

Protein Details
Accession Q6CMS6    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-68SWNIDKDTKRRIKPGKRLIPLHydrophilic
NLS Segment(s)
PositionSequence
53-64KDTKRRIKPGKR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR008402  APC_su15/mnd2  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
KEGG kla:KLLA0_E18019g  -  
Pfam View protein in Pfam  
PF05841  Apc15p  
Amino Acid Sequences MGLGEFMYGLDAFRQPSAPSDFNNIPLINNLRKELLQSKTSRKGKPVSWNIDKDTKRRIKPGKRLIPLAAYTCHSEKPLIANNDGDVSDSNTINILDKSTLLLIRSLGYSSLRPIGIDKTLKEIEKEKGSKQNKQQNEHNSGQEPILNAYQTSSSFIVSNHNHQHTEQSVLLTAQVGEQSEEEYDQSYDYDNEYAEVHEQGSMLDRTRGTFVEDSQLIDTSYTNRSRSRHSNVDALPFVNENEDSVHEQPSLTISDTLDSGAQGSRVSSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.18
4 0.25
5 0.25
6 0.25
7 0.32
8 0.32
9 0.34
10 0.38
11 0.33
12 0.27
13 0.3
14 0.34
15 0.31
16 0.32
17 0.31
18 0.28
19 0.28
20 0.32
21 0.34
22 0.33
23 0.35
24 0.39
25 0.46
26 0.55
27 0.62
28 0.62
29 0.61
30 0.62
31 0.62
32 0.67
33 0.68
34 0.68
35 0.69
36 0.7
37 0.68
38 0.71
39 0.68
40 0.61
41 0.62
42 0.61
43 0.57
44 0.62
45 0.68
46 0.69
47 0.76
48 0.83
49 0.82
50 0.78
51 0.78
52 0.7
53 0.65
54 0.57
55 0.49
56 0.4
57 0.31
58 0.29
59 0.26
60 0.24
61 0.2
62 0.18
63 0.16
64 0.19
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.25
71 0.24
72 0.19
73 0.12
74 0.11
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.11
81 0.1
82 0.09
83 0.07
84 0.07
85 0.08
86 0.08
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.11
99 0.1
100 0.1
101 0.11
102 0.12
103 0.15
104 0.17
105 0.16
106 0.19
107 0.21
108 0.21
109 0.22
110 0.23
111 0.23
112 0.28
113 0.3
114 0.28
115 0.36
116 0.39
117 0.45
118 0.5
119 0.56
120 0.55
121 0.58
122 0.62
123 0.6
124 0.63
125 0.59
126 0.52
127 0.45
128 0.39
129 0.34
130 0.28
131 0.2
132 0.14
133 0.12
134 0.1
135 0.08
136 0.08
137 0.09
138 0.08
139 0.1
140 0.09
141 0.08
142 0.09
143 0.09
144 0.16
145 0.16
146 0.22
147 0.26
148 0.27
149 0.28
150 0.27
151 0.31
152 0.25
153 0.28
154 0.22
155 0.17
156 0.15
157 0.14
158 0.14
159 0.11
160 0.1
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.07
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.09
177 0.09
178 0.08
179 0.08
180 0.09
181 0.09
182 0.09
183 0.09
184 0.08
185 0.08
186 0.08
187 0.07
188 0.1
189 0.11
190 0.11
191 0.13
192 0.13
193 0.14
194 0.16
195 0.16
196 0.17
197 0.17
198 0.17
199 0.21
200 0.21
201 0.21
202 0.2
203 0.21
204 0.17
205 0.16
206 0.15
207 0.12
208 0.18
209 0.2
210 0.22
211 0.26
212 0.28
213 0.35
214 0.44
215 0.49
216 0.52
217 0.52
218 0.58
219 0.56
220 0.61
221 0.55
222 0.47
223 0.4
224 0.32
225 0.28
226 0.22
227 0.19
228 0.13
229 0.13
230 0.15
231 0.18
232 0.18
233 0.2
234 0.18
235 0.18
236 0.18
237 0.18
238 0.17
239 0.15
240 0.15
241 0.13
242 0.14
243 0.14
244 0.15
245 0.13
246 0.11
247 0.1
248 0.09
249 0.1
250 0.09
251 0.09