Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093YJY4

Protein Details
Accession A0A093YJY4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-154EESRKELCKKLDKNDKWSKIIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, mito 8, cyto 6.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000850  Adenylat/UMP-CMP_kin  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0019205  F:nucleobase-containing compound kinase activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF00406  ADK  
Amino Acid Sequences MTAQISIIFVIAPPGAGKGTLSAYLTNKFPVQHISVGDLLRRIKNDNTDPQVEVLAYMLNSKQFAKPELVLFFNCPKEVARQRYLTRNLEGRETDDEAMFEKRYQEYVQENEPIISQYAGKGLLLEIGTGMGAEESRKELCKKLDKNDKWSKIIGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.08
6 0.1
7 0.11
8 0.12
9 0.14
10 0.17
11 0.19
12 0.2
13 0.2
14 0.2
15 0.19
16 0.19
17 0.2
18 0.21
19 0.21
20 0.21
21 0.22
22 0.23
23 0.23
24 0.23
25 0.22
26 0.22
27 0.21
28 0.22
29 0.22
30 0.22
31 0.28
32 0.33
33 0.38
34 0.4
35 0.4
36 0.39
37 0.37
38 0.34
39 0.27
40 0.21
41 0.13
42 0.09
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.1
50 0.11
51 0.12
52 0.14
53 0.15
54 0.17
55 0.18
56 0.18
57 0.16
58 0.18
59 0.2
60 0.18
61 0.17
62 0.15
63 0.13
64 0.19
65 0.25
66 0.29
67 0.29
68 0.34
69 0.37
70 0.44
71 0.5
72 0.46
73 0.42
74 0.41
75 0.37
76 0.36
77 0.33
78 0.28
79 0.25
80 0.24
81 0.22
82 0.17
83 0.16
84 0.15
85 0.16
86 0.14
87 0.11
88 0.11
89 0.11
90 0.13
91 0.13
92 0.15
93 0.18
94 0.2
95 0.23
96 0.24
97 0.24
98 0.22
99 0.22
100 0.19
101 0.16
102 0.13
103 0.1
104 0.08
105 0.09
106 0.08
107 0.08
108 0.07
109 0.07
110 0.09
111 0.08
112 0.08
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.03
119 0.04
120 0.04
121 0.05
122 0.08
123 0.1
124 0.14
125 0.16
126 0.22
127 0.3
128 0.4
129 0.47
130 0.55
131 0.64
132 0.68
133 0.76
134 0.82
135 0.81
136 0.75