Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XSH4

Protein Details
Accession A0A093XSH4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
270-297LFFKAPSATVKKQKKKVSKEGIVKGENKHydrophilic
NLS Segment(s)
PositionSequence
50-74KRIRRGRGPSSGKGKTSGRGHKGQK
280-288KKQKKKVSK
Subcellular Location(s) mito 20, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR030878  Ribosomal_L15  
IPR005749  Ribosomal_L15_bac-type  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00828  Ribosomal_L27A  
Amino Acid Sequences MPPRLPALTAALRPAQNTNGIVSAFLVPFLQARNASILSNLQDKDEAYSKRIRRGRGPSSGKGKTSGRGHKGQKQHGSVPARFQGGQTTQDVVHHQKGGENFFSVEMSPINLNRIQDWIDQGRLDPTKPITVKELAESRCLHGVKNDGVKLLARGKEELKTPINILVSRASAAAIEAVEAAGGKVTTRYYTKQSLRRLLKGESESSFTPLGMISAEDSAEQTESPILAQAKPFSYRLPDPTSRKDIEYYRDPAHRGYLSHLIAEGEGPSLFFKAPSATVKKQKKKVSKEGIVKGENKLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.27
4 0.27
5 0.25
6 0.22
7 0.21
8 0.19
9 0.18
10 0.19
11 0.14
12 0.14
13 0.12
14 0.1
15 0.11
16 0.12
17 0.14
18 0.11
19 0.13
20 0.16
21 0.17
22 0.17
23 0.17
24 0.18
25 0.18
26 0.23
27 0.22
28 0.2
29 0.2
30 0.2
31 0.23
32 0.27
33 0.26
34 0.24
35 0.33
36 0.35
37 0.44
38 0.48
39 0.49
40 0.51
41 0.59
42 0.63
43 0.65
44 0.69
45 0.68
46 0.73
47 0.73
48 0.65
49 0.61
50 0.55
51 0.52
52 0.53
53 0.54
54 0.51
55 0.55
56 0.6
57 0.62
58 0.69
59 0.71
60 0.7
61 0.65
62 0.64
63 0.63
64 0.63
65 0.57
66 0.54
67 0.49
68 0.43
69 0.38
70 0.34
71 0.31
72 0.27
73 0.27
74 0.23
75 0.21
76 0.19
77 0.2
78 0.23
79 0.22
80 0.22
81 0.21
82 0.2
83 0.21
84 0.23
85 0.25
86 0.22
87 0.19
88 0.17
89 0.15
90 0.16
91 0.13
92 0.11
93 0.08
94 0.08
95 0.08
96 0.08
97 0.1
98 0.11
99 0.11
100 0.11
101 0.12
102 0.13
103 0.13
104 0.16
105 0.16
106 0.15
107 0.15
108 0.15
109 0.18
110 0.17
111 0.16
112 0.15
113 0.14
114 0.19
115 0.2
116 0.2
117 0.19
118 0.21
119 0.21
120 0.22
121 0.26
122 0.22
123 0.25
124 0.25
125 0.23
126 0.25
127 0.25
128 0.22
129 0.18
130 0.2
131 0.19
132 0.23
133 0.22
134 0.17
135 0.17
136 0.17
137 0.18
138 0.19
139 0.18
140 0.15
141 0.16
142 0.17
143 0.19
144 0.2
145 0.23
146 0.2
147 0.18
148 0.18
149 0.19
150 0.2
151 0.18
152 0.17
153 0.14
154 0.13
155 0.12
156 0.12
157 0.09
158 0.07
159 0.07
160 0.06
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.06
174 0.09
175 0.11
176 0.16
177 0.25
178 0.32
179 0.39
180 0.46
181 0.54
182 0.57
183 0.6
184 0.59
185 0.53
186 0.53
187 0.48
188 0.44
189 0.35
190 0.33
191 0.29
192 0.28
193 0.25
194 0.18
195 0.16
196 0.12
197 0.11
198 0.08
199 0.07
200 0.05
201 0.05
202 0.06
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.09
213 0.1
214 0.11
215 0.12
216 0.14
217 0.16
218 0.19
219 0.2
220 0.18
221 0.22
222 0.25
223 0.29
224 0.35
225 0.4
226 0.45
227 0.51
228 0.57
229 0.54
230 0.52
231 0.51
232 0.48
233 0.47
234 0.47
235 0.45
236 0.44
237 0.46
238 0.45
239 0.42
240 0.43
241 0.38
242 0.32
243 0.32
244 0.34
245 0.31
246 0.29
247 0.29
248 0.23
249 0.21
250 0.21
251 0.16
252 0.09
253 0.08
254 0.08
255 0.08
256 0.08
257 0.08
258 0.08
259 0.08
260 0.1
261 0.13
262 0.2
263 0.28
264 0.35
265 0.46
266 0.57
267 0.66
268 0.73
269 0.8
270 0.83
271 0.85
272 0.88
273 0.88
274 0.88
275 0.88
276 0.88
277 0.87
278 0.83
279 0.76