Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ADJ3

Protein Details
Accession A0A094ADJ3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-70GEKEGHYDKKSKKCRKAHRRYHADGGTPBasic
NLS Segment(s)
PositionSequence
52-60KSKKCRKAH
Subcellular Location(s) cyto_nucl 14.5, nucl 12, cyto 11
Family & Domain DBs
Amino Acid Sequences MPDAYDNEAEQHDGAIRAKDIDKYLEHGIPIVAVDRAVKVLDGEKEGHYDKKSKKCRKAHRRYHADGGTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.13
5 0.14
6 0.16
7 0.16
8 0.17
9 0.16
10 0.19
11 0.21
12 0.2
13 0.19
14 0.17
15 0.15
16 0.12
17 0.12
18 0.08
19 0.05
20 0.04
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.04
27 0.07
28 0.08
29 0.09
30 0.11
31 0.11
32 0.14
33 0.16
34 0.2
35 0.2
36 0.27
37 0.33
38 0.42
39 0.53
40 0.6
41 0.69
42 0.75
43 0.85
44 0.88
45 0.92
46 0.93
47 0.93
48 0.93
49 0.9
50 0.9