Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YJM8

Protein Details
Accession A0A093YJM8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-72RHPRARNTLQRDPRRPRPRPPLRRSRIPPLHRDRRDBasic
NLS Segment(s)
PositionSequence
36-71PRHPRARNTLQRDPRRPRPRPPLRRSRIPPLHRDRR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSLPPSRNPLRALHALETARRLRAPKDLYLPLLPPRHPRARNTLQRDPRRPRPRPPLRRSRIPPLHRDRRDQPLGQRHRPLAADIPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.39
4 0.38
5 0.4
6 0.35
7 0.31
8 0.28
9 0.27
10 0.24
11 0.3
12 0.33
13 0.31
14 0.35
15 0.36
16 0.36
17 0.36
18 0.36
19 0.34
20 0.34
21 0.31
22 0.31
23 0.35
24 0.41
25 0.42
26 0.43
27 0.46
28 0.52
29 0.59
30 0.62
31 0.65
32 0.66
33 0.72
34 0.79
35 0.78
36 0.79
37 0.8
38 0.77
39 0.77
40 0.79
41 0.81
42 0.83
43 0.85
44 0.85
45 0.82
46 0.87
47 0.84
48 0.84
49 0.83
50 0.78
51 0.79
52 0.78
53 0.81
54 0.76
55 0.77
56 0.72
57 0.71
58 0.72
59 0.67
60 0.66
61 0.66
62 0.71
63 0.71
64 0.73
65 0.65
66 0.62
67 0.58
68 0.52