Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZY86

Protein Details
Accession A0A093ZY86   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-87TVSSVEIRRRKPRRHGSRSSHGTPHydrophilic
NLS Segment(s)
PositionSequence
71-80RRRKPRRHGS
Subcellular Location(s) plas 13, mito 6, cyto 4, vacu 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPIPLHPRDDGFKAIPSTYSSLNGPPAGQIVGIVLGSVAGFILIAYLIYTTCGGSVVISDDETVSSVEIRRRKPRRHGSRSSHGTPVVERIVVQERTERRSGSRMSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.25
5 0.25
6 0.21
7 0.21
8 0.18
9 0.18
10 0.2
11 0.19
12 0.17
13 0.14
14 0.14
15 0.12
16 0.1
17 0.08
18 0.06
19 0.06
20 0.05
21 0.05
22 0.03
23 0.03
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.04
53 0.05
54 0.07
55 0.12
56 0.17
57 0.23
58 0.33
59 0.42
60 0.5
61 0.61
62 0.7
63 0.77
64 0.81
65 0.86
66 0.85
67 0.87
68 0.87
69 0.8
70 0.73
71 0.63
72 0.55
73 0.45
74 0.41
75 0.32
76 0.24
77 0.2
78 0.19
79 0.24
80 0.25
81 0.25
82 0.27
83 0.3
84 0.35
85 0.39
86 0.37
87 0.33
88 0.39
89 0.41