Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093Y1R9

Protein Details
Accession A0A093Y1R9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-47YVSPTGKPPPKPKVRRNIMLEKFRAHydrophilic
NLS Segment(s)
PositionSequence
32-35PKPK
Subcellular Location(s) cyto 14, cyto_nucl 11.333, cyto_pero 8.333, nucl 7.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045038  AIG2-like  
IPR009288  AIG2-like_dom  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
Pfam View protein in Pfam  
PF06094  GGACT  
CDD cd06661  GGCT_like  
Amino Acid Sequences MEGTRGSLSASKVDNDEKKGLGYVSPTGKPPPKPKVRRNIMLEKFRADVEPSLPPYTYTPIPFFFYGTLTDPLRLQEVLQLSAPPVLKPARVRCYKIMLWGQYPALVHGPMNNYVDGMAFVVETEEQQRKLEYYETDAYHMEGIQISVDGKAVIGSTFMWAHDPADLEEGTWSLEEWKKDIEEEMASHFRPLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.33
5 0.32
6 0.32
7 0.3
8 0.23
9 0.21
10 0.21
11 0.23
12 0.25
13 0.26
14 0.31
15 0.37
16 0.43
17 0.49
18 0.54
19 0.6
20 0.68
21 0.76
22 0.8
23 0.83
24 0.85
25 0.84
26 0.84
27 0.82
28 0.81
29 0.74
30 0.65
31 0.57
32 0.48
33 0.41
34 0.32
35 0.25
36 0.19
37 0.22
38 0.22
39 0.22
40 0.22
41 0.22
42 0.21
43 0.23
44 0.23
45 0.2
46 0.19
47 0.2
48 0.23
49 0.22
50 0.21
51 0.18
52 0.16
53 0.16
54 0.16
55 0.18
56 0.15
57 0.15
58 0.15
59 0.15
60 0.15
61 0.13
62 0.1
63 0.11
64 0.11
65 0.12
66 0.12
67 0.11
68 0.1
69 0.13
70 0.13
71 0.1
72 0.11
73 0.11
74 0.13
75 0.17
76 0.23
77 0.29
78 0.32
79 0.36
80 0.36
81 0.41
82 0.39
83 0.41
84 0.39
85 0.32
86 0.29
87 0.27
88 0.25
89 0.2
90 0.19
91 0.14
92 0.11
93 0.09
94 0.08
95 0.09
96 0.11
97 0.12
98 0.13
99 0.12
100 0.11
101 0.11
102 0.11
103 0.09
104 0.07
105 0.05
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04
111 0.08
112 0.1
113 0.1
114 0.11
115 0.12
116 0.12
117 0.14
118 0.16
119 0.14
120 0.17
121 0.22
122 0.22
123 0.23
124 0.23
125 0.22
126 0.2
127 0.18
128 0.13
129 0.08
130 0.08
131 0.06
132 0.06
133 0.06
134 0.05
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.1
149 0.11
150 0.12
151 0.11
152 0.13
153 0.13
154 0.11
155 0.11
156 0.11
157 0.1
158 0.09
159 0.08
160 0.11
161 0.15
162 0.15
163 0.17
164 0.19
165 0.2
166 0.2
167 0.22
168 0.2
169 0.19
170 0.19
171 0.24
172 0.26
173 0.26
174 0.26