Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JV11

Protein Details
Accession C4JV11    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-48HTTRITTKYSYPKPPRKSKPTTDTTSHydrophilic
NLS Segment(s)
PositionSequence
159-175GNGGGGGKKKKSGKGKR
Subcellular Location(s) nucl 16, cyto_nucl 12, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG ure:UREG_04964  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFSNSQEFLKQSSLLLQAYPHTTRITTKYSYPKPPRKSKPTTDTTSSSTPAPPPTSSQSTSTPATLTLKTYNPHTGICLKYRTTKAAEVSRLIAGLGRLASGAPITDAPTVATPALTETPTQAQSHTVTSVSGRDADMLDVADVTGVGSDAQGNAKGNGGGGGKKKKSGKGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.21
4 0.2
5 0.18
6 0.18
7 0.22
8 0.23
9 0.21
10 0.19
11 0.19
12 0.22
13 0.26
14 0.29
15 0.26
16 0.32
17 0.4
18 0.47
19 0.57
20 0.64
21 0.69
22 0.74
23 0.82
24 0.85
25 0.85
26 0.87
27 0.86
28 0.85
29 0.83
30 0.8
31 0.74
32 0.68
33 0.62
34 0.56
35 0.48
36 0.39
37 0.33
38 0.28
39 0.26
40 0.25
41 0.21
42 0.22
43 0.26
44 0.3
45 0.3
46 0.31
47 0.3
48 0.32
49 0.32
50 0.29
51 0.23
52 0.2
53 0.2
54 0.18
55 0.16
56 0.15
57 0.17
58 0.17
59 0.19
60 0.22
61 0.2
62 0.2
63 0.2
64 0.22
65 0.21
66 0.23
67 0.24
68 0.21
69 0.26
70 0.27
71 0.28
72 0.26
73 0.27
74 0.28
75 0.3
76 0.31
77 0.26
78 0.26
79 0.23
80 0.2
81 0.17
82 0.13
83 0.08
84 0.07
85 0.06
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.07
101 0.07
102 0.05
103 0.07
104 0.08
105 0.08
106 0.08
107 0.09
108 0.12
109 0.14
110 0.15
111 0.13
112 0.14
113 0.15
114 0.17
115 0.16
116 0.13
117 0.12
118 0.12
119 0.14
120 0.12
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.09
128 0.08
129 0.07
130 0.06
131 0.05
132 0.05
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.05
140 0.06
141 0.09
142 0.1
143 0.11
144 0.12
145 0.12
146 0.12
147 0.14
148 0.15
149 0.17
150 0.24
151 0.34
152 0.35
153 0.42
154 0.48
155 0.53