Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093Y811

Protein Details
Accession A0A093Y811    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58HPFPGKEHLRQPPKRNGQILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto_mito 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR036374  OxRdtase_Mopterin-bd_sf  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MATRKLFRQFWRPVSKLCTGELAATPIRRTIQTSAKHAHPFPGKEHLRQPPKRNGQILALTGGGVLTILLGSQVAFPSHEKSVSKASPSHETSNQPQSRTEPETQPELKEGVQYYRLDEIRSHDGASARPWVTRGTSVYDITEWIPAHPGGEVILRACGGSLDPYWDIFSIHKRKDVYEILEEYKIGEISPLDLVDGKLPAATVPDPFIADPERDPRLLTLTARPRNAETPAEGLSPFLTPTPLFYVRNHMWVPPVEANEHSLTITLPSGDEKTYTLEDLKTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.6
4 0.51
5 0.46
6 0.36
7 0.36
8 0.32
9 0.3
10 0.26
11 0.26
12 0.26
13 0.24
14 0.25
15 0.23
16 0.25
17 0.26
18 0.32
19 0.36
20 0.42
21 0.45
22 0.5
23 0.54
24 0.51
25 0.54
26 0.52
27 0.49
28 0.46
29 0.51
30 0.48
31 0.47
32 0.55
33 0.57
34 0.6
35 0.66
36 0.71
37 0.71
38 0.77
39 0.8
40 0.76
41 0.68
42 0.63
43 0.6
44 0.52
45 0.43
46 0.33
47 0.25
48 0.21
49 0.18
50 0.11
51 0.06
52 0.04
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.04
60 0.04
61 0.05
62 0.06
63 0.08
64 0.11
65 0.12
66 0.15
67 0.15
68 0.17
69 0.24
70 0.25
71 0.27
72 0.27
73 0.29
74 0.34
75 0.38
76 0.4
77 0.37
78 0.39
79 0.42
80 0.49
81 0.49
82 0.42
83 0.39
84 0.37
85 0.39
86 0.4
87 0.38
88 0.32
89 0.31
90 0.37
91 0.37
92 0.35
93 0.3
94 0.26
95 0.23
96 0.21
97 0.2
98 0.15
99 0.18
100 0.17
101 0.17
102 0.21
103 0.21
104 0.19
105 0.19
106 0.21
107 0.23
108 0.23
109 0.22
110 0.18
111 0.19
112 0.19
113 0.19
114 0.2
115 0.16
116 0.15
117 0.16
118 0.15
119 0.15
120 0.16
121 0.15
122 0.14
123 0.16
124 0.16
125 0.16
126 0.15
127 0.15
128 0.13
129 0.15
130 0.11
131 0.09
132 0.1
133 0.09
134 0.09
135 0.08
136 0.08
137 0.05
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.05
148 0.05
149 0.07
150 0.07
151 0.08
152 0.08
153 0.09
154 0.09
155 0.09
156 0.18
157 0.23
158 0.24
159 0.28
160 0.28
161 0.29
162 0.34
163 0.37
164 0.32
165 0.29
166 0.31
167 0.29
168 0.29
169 0.28
170 0.22
171 0.19
172 0.16
173 0.11
174 0.08
175 0.06
176 0.06
177 0.07
178 0.06
179 0.06
180 0.07
181 0.07
182 0.08
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.07
189 0.08
190 0.07
191 0.09
192 0.09
193 0.1
194 0.1
195 0.12
196 0.11
197 0.12
198 0.13
199 0.17
200 0.19
201 0.18
202 0.19
203 0.18
204 0.2
205 0.21
206 0.21
207 0.25
208 0.33
209 0.39
210 0.4
211 0.42
212 0.41
213 0.42
214 0.44
215 0.37
216 0.29
217 0.26
218 0.26
219 0.26
220 0.22
221 0.19
222 0.16
223 0.14
224 0.13
225 0.1
226 0.09
227 0.08
228 0.11
229 0.17
230 0.2
231 0.22
232 0.23
233 0.31
234 0.32
235 0.38
236 0.37
237 0.31
238 0.31
239 0.3
240 0.36
241 0.31
242 0.31
243 0.27
244 0.27
245 0.3
246 0.28
247 0.27
248 0.2
249 0.16
250 0.14
251 0.14
252 0.14
253 0.1
254 0.09
255 0.11
256 0.12
257 0.13
258 0.13
259 0.13
260 0.17
261 0.18
262 0.2
263 0.2
264 0.21