Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XMP3

Protein Details
Accession A0A093XMP3   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
16-41ARDDDDERPKKRKKNKGKEGAYDDDEAcidic
45-70KGLLTPSSTKPRKRRPKSFGTPSGDSHydrophilic
NLS Segment(s)
PositionSequence
23-33RPKKRKKNKGK
54-61KPRKRRPK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MPHSHDRRLEMISESARDDDDERPKKRKKNKGKEGAYDDDETDNKGLLTPSSTKPRKRRPKSFGTPSGDSQTRASPPLHKRLKPTSTSLATPKMARENLTEDQKRENHIKSEQKRRTLIKEGFEDLNELVPELRGGGFSKSAVLVMAADWLEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.23
4 0.22
5 0.21
6 0.22
7 0.3
8 0.37
9 0.41
10 0.5
11 0.58
12 0.66
13 0.74
14 0.79
15 0.8
16 0.82
17 0.88
18 0.89
19 0.9
20 0.9
21 0.87
22 0.82
23 0.74
24 0.64
25 0.54
26 0.46
27 0.37
28 0.29
29 0.22
30 0.16
31 0.11
32 0.11
33 0.1
34 0.07
35 0.1
36 0.13
37 0.16
38 0.27
39 0.33
40 0.4
41 0.5
42 0.61
43 0.69
44 0.75
45 0.82
46 0.79
47 0.84
48 0.86
49 0.86
50 0.85
51 0.8
52 0.73
53 0.64
54 0.62
55 0.52
56 0.43
57 0.34
58 0.28
59 0.21
60 0.2
61 0.19
62 0.22
63 0.25
64 0.34
65 0.39
66 0.39
67 0.44
68 0.5
69 0.55
70 0.49
71 0.5
72 0.47
73 0.42
74 0.42
75 0.4
76 0.35
77 0.31
78 0.29
79 0.26
80 0.25
81 0.23
82 0.22
83 0.22
84 0.24
85 0.27
86 0.35
87 0.36
88 0.32
89 0.37
90 0.38
91 0.4
92 0.39
93 0.37
94 0.33
95 0.39
96 0.48
97 0.5
98 0.6
99 0.63
100 0.65
101 0.69
102 0.69
103 0.68
104 0.68
105 0.64
106 0.59
107 0.56
108 0.53
109 0.48
110 0.43
111 0.38
112 0.28
113 0.26
114 0.19
115 0.15
116 0.12
117 0.1
118 0.1
119 0.09
120 0.09
121 0.07
122 0.08
123 0.1
124 0.11
125 0.11
126 0.12
127 0.12
128 0.12
129 0.1
130 0.1
131 0.08
132 0.07
133 0.1
134 0.08