Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AUF9

Protein Details
Accession A0A094AUF9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MADKKDDKKDGRKDSKKDNDKDSKEDGKKDDKTYNKKDRKKDDKKDDKKDSKGKIEFBasic
NLS Segment(s)
PositionSequence
7-54DKKDGRKDSKKDNDKDSKEDGKKDDKTYNKKDRKKDDKKDDKKDSKGK
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
Amino Acid Sequences MADKKDDKKDGRKDSKKDNDKDSKEDGKKDDKTYNKKDRKKDDKKDDKKDSKGKIEFSPAIPIPFVFDVPARIKALQGYLDPSNPSYQPELQHINIRAVIKLYEEGKLNGLERTTVIDGKVAPHEEAFTSKTGSWTEGMVFQRAQRVAGGHGLFRHGYEVGGSALAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.84
5 0.83
6 0.83
7 0.78
8 0.77
9 0.74
10 0.74
11 0.69
12 0.68
13 0.64
14 0.62
15 0.63
16 0.62
17 0.62
18 0.62
19 0.66
20 0.7
21 0.76
22 0.77
23 0.79
24 0.84
25 0.86
26 0.88
27 0.89
28 0.9
29 0.9
30 0.91
31 0.93
32 0.94
33 0.94
34 0.92
35 0.9
36 0.88
37 0.83
38 0.82
39 0.76
40 0.69
41 0.6
42 0.58
43 0.51
44 0.43
45 0.42
46 0.32
47 0.29
48 0.25
49 0.21
50 0.17
51 0.15
52 0.14
53 0.08
54 0.08
55 0.11
56 0.13
57 0.15
58 0.14
59 0.14
60 0.14
61 0.14
62 0.15
63 0.13
64 0.11
65 0.12
66 0.11
67 0.12
68 0.12
69 0.12
70 0.13
71 0.12
72 0.13
73 0.12
74 0.13
75 0.14
76 0.17
77 0.2
78 0.19
79 0.24
80 0.24
81 0.22
82 0.23
83 0.23
84 0.19
85 0.16
86 0.15
87 0.11
88 0.12
89 0.12
90 0.11
91 0.12
92 0.12
93 0.13
94 0.14
95 0.14
96 0.13
97 0.12
98 0.1
99 0.09
100 0.12
101 0.12
102 0.12
103 0.11
104 0.12
105 0.12
106 0.14
107 0.17
108 0.15
109 0.13
110 0.13
111 0.14
112 0.13
113 0.15
114 0.15
115 0.13
116 0.14
117 0.14
118 0.16
119 0.16
120 0.16
121 0.15
122 0.14
123 0.14
124 0.18
125 0.19
126 0.19
127 0.2
128 0.19
129 0.25
130 0.25
131 0.24
132 0.2
133 0.19
134 0.19
135 0.25
136 0.24
137 0.2
138 0.2
139 0.22
140 0.21
141 0.2
142 0.21
143 0.14
144 0.13
145 0.12
146 0.13
147 0.1