Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JEQ4

Protein Details
Accession C4JEQ4    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
239-259IPGSQQHKRPRRRYEEIERMYHydrophilic
296-319EFKEIRKEWKARKKEEENQRKAAEBasic
NLS Segment(s)
PositionSequence
301-313RKEWKARKKEEEN
315-315R
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
KEGG ure:UREG_02214  -  
Amino Acid Sequences MDRPAPDYAQSGLNSEPPNLAEQDSEQSAADQTPAAAAVASPQYNTSQPENRAPAQYTAPAESRTAGNLSTSNTPQPDYTLNQTAQPPPPPAARPPPYPDYLARQPQYHHAPNTQAGGAAGMAQATSPSMNLQDGPQNDHRNPTQIKSDTDVPIDPSIAAASPTYPPPYSPYQPQGHDMAQYQGHPPPQMYARPDWPHQYGQHQGLPGPYSSPATTVGTASPVTTAGPRPGQVYSFVPIPGSQQHKRPRRRYEEIERMYKFSWRKANSRRSLPQLMTSSLASIDERLIHSFSIPPEFKEIRKEWKARKKEEENQRKAAEERERAAAQGADSNAPPDPNNVTAAQQPPQPAPYPAGVRPQLPPIGYQPADGQVPNQYGNSTGSGLVYPSGNGQIPATYPTNYPHSPYGQGSQVYQQPPPPPRPDGQFSSYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.2
5 0.23
6 0.22
7 0.21
8 0.17
9 0.17
10 0.21
11 0.21
12 0.21
13 0.18
14 0.17
15 0.17
16 0.16
17 0.15
18 0.1
19 0.09
20 0.08
21 0.08
22 0.08
23 0.06
24 0.06
25 0.08
26 0.12
27 0.13
28 0.12
29 0.13
30 0.16
31 0.18
32 0.22
33 0.25
34 0.29
35 0.33
36 0.41
37 0.46
38 0.47
39 0.49
40 0.48
41 0.45
42 0.41
43 0.41
44 0.35
45 0.33
46 0.32
47 0.29
48 0.27
49 0.25
50 0.23
51 0.2
52 0.18
53 0.15
54 0.14
55 0.14
56 0.16
57 0.2
58 0.21
59 0.23
60 0.23
61 0.24
62 0.23
63 0.24
64 0.25
65 0.23
66 0.27
67 0.3
68 0.29
69 0.31
70 0.35
71 0.37
72 0.38
73 0.39
74 0.35
75 0.32
76 0.36
77 0.35
78 0.37
79 0.42
80 0.43
81 0.45
82 0.49
83 0.51
84 0.49
85 0.5
86 0.46
87 0.44
88 0.47
89 0.5
90 0.46
91 0.43
92 0.42
93 0.46
94 0.52
95 0.5
96 0.45
97 0.4
98 0.42
99 0.42
100 0.43
101 0.35
102 0.26
103 0.2
104 0.17
105 0.14
106 0.1
107 0.08
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.08
120 0.12
121 0.13
122 0.19
123 0.25
124 0.3
125 0.31
126 0.35
127 0.34
128 0.37
129 0.38
130 0.35
131 0.36
132 0.34
133 0.35
134 0.34
135 0.39
136 0.33
137 0.33
138 0.31
139 0.25
140 0.22
141 0.21
142 0.17
143 0.11
144 0.1
145 0.08
146 0.08
147 0.05
148 0.06
149 0.07
150 0.08
151 0.1
152 0.1
153 0.1
154 0.14
155 0.2
156 0.21
157 0.25
158 0.31
159 0.33
160 0.35
161 0.37
162 0.36
163 0.31
164 0.3
165 0.27
166 0.22
167 0.18
168 0.17
169 0.17
170 0.16
171 0.16
172 0.15
173 0.14
174 0.14
175 0.15
176 0.18
177 0.19
178 0.2
179 0.25
180 0.28
181 0.3
182 0.32
183 0.32
184 0.32
185 0.31
186 0.32
187 0.3
188 0.3
189 0.3
190 0.27
191 0.24
192 0.22
193 0.21
194 0.17
195 0.13
196 0.1
197 0.09
198 0.09
199 0.09
200 0.1
201 0.1
202 0.1
203 0.1
204 0.09
205 0.09
206 0.1
207 0.09
208 0.07
209 0.06
210 0.06
211 0.07
212 0.07
213 0.08
214 0.09
215 0.1
216 0.11
217 0.11
218 0.12
219 0.13
220 0.13
221 0.13
222 0.13
223 0.13
224 0.11
225 0.11
226 0.12
227 0.15
228 0.2
229 0.21
230 0.28
231 0.38
232 0.47
233 0.57
234 0.65
235 0.7
236 0.73
237 0.79
238 0.8
239 0.8
240 0.82
241 0.78
242 0.77
243 0.68
244 0.62
245 0.54
246 0.51
247 0.42
248 0.37
249 0.39
250 0.35
251 0.43
252 0.5
253 0.6
254 0.62
255 0.69
256 0.68
257 0.67
258 0.69
259 0.61
260 0.57
261 0.5
262 0.44
263 0.37
264 0.31
265 0.24
266 0.18
267 0.18
268 0.11
269 0.09
270 0.08
271 0.08
272 0.09
273 0.1
274 0.1
275 0.09
276 0.1
277 0.12
278 0.12
279 0.19
280 0.18
281 0.18
282 0.24
283 0.26
284 0.27
285 0.33
286 0.35
287 0.37
288 0.45
289 0.53
290 0.56
291 0.65
292 0.73
293 0.73
294 0.8
295 0.8
296 0.8
297 0.84
298 0.85
299 0.82
300 0.8
301 0.74
302 0.66
303 0.58
304 0.56
305 0.54
306 0.47
307 0.42
308 0.4
309 0.38
310 0.36
311 0.36
312 0.29
313 0.21
314 0.19
315 0.18
316 0.14
317 0.14
318 0.15
319 0.14
320 0.14
321 0.14
322 0.12
323 0.14
324 0.14
325 0.17
326 0.16
327 0.17
328 0.21
329 0.24
330 0.24
331 0.24
332 0.25
333 0.24
334 0.26
335 0.26
336 0.23
337 0.23
338 0.25
339 0.27
340 0.28
341 0.35
342 0.34
343 0.34
344 0.34
345 0.36
346 0.35
347 0.31
348 0.3
349 0.26
350 0.32
351 0.31
352 0.3
353 0.26
354 0.26
355 0.27
356 0.25
357 0.22
358 0.19
359 0.21
360 0.21
361 0.2
362 0.17
363 0.17
364 0.19
365 0.2
366 0.16
367 0.14
368 0.13
369 0.13
370 0.13
371 0.12
372 0.11
373 0.09
374 0.1
375 0.12
376 0.12
377 0.12
378 0.12
379 0.12
380 0.13
381 0.17
382 0.18
383 0.17
384 0.18
385 0.21
386 0.28
387 0.28
388 0.31
389 0.31
390 0.32
391 0.35
392 0.37
393 0.38
394 0.36
395 0.36
396 0.34
397 0.35
398 0.39
399 0.37
400 0.36
401 0.38
402 0.4
403 0.47
404 0.53
405 0.53
406 0.51
407 0.54
408 0.59
409 0.61
410 0.59