FuNGI

A0A093XTB0

Protein Details

Accession

A0A093XTB0

Localization Confidence

High

Confidence Score

20.5

NoLS Segment(s)

Position	Sequence	Protein Nature
274-297	TSGAEKPAKKTKKKINPFRFDSPD	Hydrophilic
300-325	GEALRRSADRRKLRRQRKLQEELAYN	Hydrophilic

NLS Segment(s)

Position	Sequence
279-290	KPAKKTKKKINP
303-317	LRRSADRRKLRRQRK

Subcellular Location(s)

nucl 22, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR025124 DUF4050
Pfam	View protein in Pfam PF13259 DUF4050

Amino Acid Sequences

MGQAGNSPQSGDQQPINDVAATATAHGDSVNSLRGNQINPTSPPNSQPVEQPGPALSAAQILPVTATSVSESIDVVDAPNVASPTTQSRPPVESHETILQGGEPTDLANPAFIIRTSAPAPGSMPASDANGLPIDQSTPPGFTFPTRSNTEFIASFPQTSTNSSSMLFTHGAGAAHRRRSMANTSAITEYEADLTSKDRLKQKEAVRNILASKIRNDWTFPNVVDDAELEPSEALPEGDPEQPTTWIERGDWLSELSDSSDSDNGLAQTSTNSTSGAEKPAKKTKKKINPFRFDSPDGVGEALRRSADRRKLRRQRKLQEELAYNEGLRCFTARRNAWTNARIVRRPRCAAASPTSPNGEKSPAGTDDEEAILDTLLPIAPPLLPPSTPMRRNITSRAHSTIYDKVVMQSQTPMCPINLQTVVSSCVDGWKRDGEWPPRGTEPEATLARRRNVEAAGAAQKGVWRRSLQKVFGRAGTEIV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.26
3	0.27
4	0.21
5	0.19
6	0.16
7	0.15
8	0.12
9	0.11
10	0.1
11	0.09
12	0.08
13	0.08
14	0.08
15	0.08
16	0.1
17	0.14
18	0.14
19	0.14
20	0.18
21	0.21
22	0.23
23	0.26
24	0.29
25	0.29
26	0.31
27	0.37
28	0.37
29	0.36
30	0.38
31	0.39
32	0.38
33	0.34
34	0.36
35	0.39
36	0.42
37	0.4
38	0.38
39	0.33
40	0.31
41	0.3
42	0.25
43	0.16
44	0.13
45	0.12
46	0.12
47	0.11
48	0.09
49	0.09
50	0.09
51	0.1
52	0.07
53	0.08
54	0.08
55	0.08
56	0.09
57	0.09
58	0.09
59	0.08
60	0.09
61	0.08
62	0.07
63	0.08
64	0.07
65	0.07
66	0.09
67	0.08
68	0.08
69	0.08
70	0.09
71	0.15
72	0.18
73	0.21
74	0.22
75	0.26
76	0.28
77	0.31
78	0.36
79	0.36
80	0.35
81	0.36
82	0.37
83	0.34
84	0.32
85	0.3
86	0.23
87	0.17
88	0.15
89	0.12
90	0.07
91	0.07
92	0.07
93	0.08
94	0.07
95	0.07
96	0.07
97	0.07
98	0.08
99	0.07
100	0.1
101	0.09
102	0.13
103	0.14
104	0.16
105	0.15
106	0.15
107	0.16
108	0.14
109	0.16
110	0.13
111	0.13
112	0.11
113	0.12
114	0.13
115	0.12
116	0.11
117	0.1
118	0.1
119	0.09
120	0.08
121	0.08
122	0.08
123	0.1
124	0.1
125	0.11
126	0.11
127	0.12
128	0.13
129	0.12
130	0.17
131	0.18
132	0.24
133	0.27
134	0.28
135	0.29
136	0.29
137	0.3
138	0.25
139	0.23
140	0.23
141	0.2
142	0.18
143	0.17
144	0.19
145	0.18
146	0.2
147	0.22
148	0.17
149	0.17
150	0.17
151	0.17
152	0.15
153	0.17
154	0.15
155	0.11
156	0.11
157	0.12
158	0.11
159	0.11
160	0.17
161	0.19
162	0.22
163	0.23
164	0.23
165	0.22
166	0.26
167	0.31
168	0.29
169	0.3
170	0.27
171	0.28
172	0.28
173	0.27
174	0.24
175	0.19
176	0.15
177	0.1
178	0.1
179	0.08
180	0.07
181	0.09
182	0.11
183	0.13
184	0.17
185	0.22
186	0.25
187	0.29
188	0.37
189	0.43
190	0.49
191	0.51
192	0.52
193	0.47
194	0.46
195	0.42
196	0.4
197	0.35
198	0.27
199	0.25
200	0.23
201	0.24
202	0.23
203	0.24
204	0.21
205	0.21
206	0.22
207	0.2
208	0.19
209	0.17
210	0.16
211	0.14
212	0.13
213	0.11
214	0.09
215	0.09
216	0.06
217	0.05
218	0.05
219	0.05
220	0.05
221	0.04
222	0.03
223	0.04
224	0.06
225	0.08
226	0.09
227	0.1
228	0.1
229	0.11
230	0.11
231	0.13
232	0.11
233	0.1
234	0.1
235	0.12
236	0.12
237	0.12
238	0.12
239	0.1
240	0.1
241	0.1
242	0.1
243	0.08
244	0.07
245	0.07
246	0.07
247	0.07
248	0.07
249	0.07
250	0.08
251	0.07
252	0.07
253	0.07
254	0.06
255	0.06
256	0.07
257	0.08
258	0.08
259	0.08
260	0.08
261	0.1
262	0.12
263	0.17
264	0.21
265	0.22
266	0.28
267	0.38
268	0.46
269	0.49
270	0.57
271	0.62
272	0.67
273	0.75
274	0.81
275	0.82
276	0.83
277	0.84
278	0.83
279	0.79
280	0.71
281	0.62
282	0.53
283	0.43
284	0.34
285	0.27
286	0.19
287	0.14
288	0.12
289	0.11
290	0.09
291	0.08
292	0.11
293	0.18
294	0.28
295	0.37
296	0.46
297	0.56
298	0.66
299	0.77
300	0.85
301	0.88
302	0.89
303	0.89
304	0.88
305	0.84
306	0.8
307	0.74
308	0.66
309	0.58
310	0.49
311	0.38
312	0.3
313	0.24
314	0.17
315	0.13
316	0.11
317	0.09
318	0.12
319	0.21
320	0.23
321	0.29
322	0.35
323	0.4
324	0.45
325	0.47
326	0.49
327	0.47
328	0.51
329	0.5
330	0.52
331	0.55
332	0.57
333	0.57
334	0.54
335	0.52
336	0.5
337	0.5
338	0.47
339	0.46
340	0.42
341	0.42
342	0.42
343	0.38
344	0.36
345	0.32
346	0.3
347	0.23
348	0.21
349	0.22
350	0.21
351	0.23
352	0.22
353	0.21
354	0.19
355	0.19
356	0.17
357	0.13
358	0.11
359	0.08
360	0.07
361	0.06
362	0.05
363	0.04
364	0.04
365	0.04
366	0.04
367	0.05
368	0.05
369	0.08
370	0.1
371	0.1
372	0.13
373	0.21
374	0.29
375	0.32
376	0.37
377	0.42
378	0.45
379	0.5
380	0.56
381	0.57
382	0.54
383	0.56
384	0.56
385	0.5
386	0.47
387	0.46
388	0.44
389	0.37
390	0.33
391	0.29
392	0.25
393	0.29
394	0.28
395	0.25
396	0.26
397	0.25
398	0.25
399	0.27
400	0.27
401	0.21
402	0.24
403	0.24
404	0.24
405	0.24
406	0.22
407	0.21
408	0.21
409	0.24
410	0.21
411	0.21
412	0.14
413	0.19
414	0.21
415	0.21
416	0.23
417	0.24
418	0.25
419	0.32
420	0.41
421	0.41
422	0.47
423	0.49
424	0.5
425	0.5
426	0.52
427	0.48
428	0.43
429	0.38
430	0.37
431	0.39
432	0.39
433	0.42
434	0.46
435	0.48
436	0.48
437	0.47
438	0.42
439	0.39
440	0.38
441	0.34
442	0.32
443	0.33
444	0.3
445	0.28
446	0.24
447	0.26
448	0.29
449	0.29
450	0.28
451	0.27
452	0.33
453	0.44
454	0.52
455	0.57
456	0.6
457	0.65
458	0.65
459	0.64
460	0.61

A0A093XTB0

3D AlphaFold-predicted Structure Viewer