Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093XKK4

Protein Details
Accession A0A093XKK4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-25GGEEKKKKKVYGQPKGPNPLSBasic
66-88AAEGEVKKKTRRKRKAGAGAGAAHydrophilic
NLS Segment(s)
PositionSequence
8-83EKKKKKVYGQPKGPNPLSVKKAKVEKPKVEKGEGAVRKVKEEKREKSEKVEGAGGDGEAAEGEVKKKTRRKRKAGA
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences GEEAGGEEKKKKKVYGQPKGPNPLSVKKAKVEKPKVEKGEGAVRKVKEEKREKSEKVEGAGGDGEAAEGEVKKKTRRKRKAGAGAGAAEGEGGVPVVAEAADAGEAMEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.75
4 0.77
5 0.8
6 0.86
7 0.78
8 0.74
9 0.68
10 0.64
11 0.59
12 0.55
13 0.49
14 0.46
15 0.53
16 0.55
17 0.6
18 0.62
19 0.65
20 0.68
21 0.74
22 0.72
23 0.66
24 0.59
25 0.52
26 0.53
27 0.46
28 0.41
29 0.38
30 0.34
31 0.35
32 0.4
33 0.4
34 0.4
35 0.46
36 0.49
37 0.52
38 0.59
39 0.58
40 0.58
41 0.6
42 0.52
43 0.44
44 0.4
45 0.32
46 0.25
47 0.23
48 0.16
49 0.1
50 0.08
51 0.06
52 0.04
53 0.04
54 0.03
55 0.03
56 0.04
57 0.07
58 0.1
59 0.17
60 0.25
61 0.35
62 0.46
63 0.57
64 0.66
65 0.73
66 0.82
67 0.86
68 0.87
69 0.83
70 0.75
71 0.66
72 0.56
73 0.46
74 0.34
75 0.23
76 0.14
77 0.08
78 0.04
79 0.03
80 0.02
81 0.02
82 0.02
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03