Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HWW4

Protein Details
Accession A0A094HWW4    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-85GNSPERVSKRPKKASAKARLSRHydrophilic
106-126KEKMEKLRRERAHRRGKQPSLBasic
NLS Segment(s)
PositionSequence
71-85SKRPKKASAKARLSR
102-143SARAKEKMEKLRRERAHRRGKQPSLASTPASEAGHRSRRKKA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences PLSILSGLPSVNMAQLSQSESEVPTAEPPSSEPEMVLRLVCRWNDKINTSLYRDEVINPPPLYGNSPERVSKRPKKASAKARLSRAEDVKFYSADAKPSNVSARAKEKMEKLRRERAHRRGKQPSLASTPASEAGHRSRRKKAPSLSGSSGSSDLGEDSLDEVPPDIRLYAVPDHLQGTTSAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.12
5 0.13
6 0.12
7 0.12
8 0.13
9 0.13
10 0.13
11 0.13
12 0.14
13 0.14
14 0.13
15 0.14
16 0.19
17 0.2
18 0.2
19 0.17
20 0.17
21 0.18
22 0.19
23 0.18
24 0.13
25 0.13
26 0.17
27 0.18
28 0.21
29 0.22
30 0.28
31 0.32
32 0.33
33 0.34
34 0.36
35 0.39
36 0.38
37 0.37
38 0.32
39 0.29
40 0.27
41 0.27
42 0.25
43 0.23
44 0.25
45 0.23
46 0.22
47 0.21
48 0.21
49 0.21
50 0.21
51 0.23
52 0.19
53 0.21
54 0.25
55 0.27
56 0.32
57 0.39
58 0.45
59 0.51
60 0.57
61 0.64
62 0.69
63 0.75
64 0.8
65 0.81
66 0.82
67 0.78
68 0.76
69 0.72
70 0.66
71 0.62
72 0.56
73 0.47
74 0.37
75 0.34
76 0.28
77 0.23
78 0.19
79 0.19
80 0.15
81 0.16
82 0.16
83 0.15
84 0.14
85 0.15
86 0.16
87 0.16
88 0.17
89 0.17
90 0.22
91 0.24
92 0.26
93 0.28
94 0.33
95 0.39
96 0.47
97 0.53
98 0.54
99 0.61
100 0.66
101 0.73
102 0.76
103 0.76
104 0.79
105 0.78
106 0.81
107 0.81
108 0.8
109 0.78
110 0.72
111 0.67
112 0.62
113 0.56
114 0.47
115 0.37
116 0.33
117 0.29
118 0.25
119 0.2
120 0.17
121 0.22
122 0.3
123 0.36
124 0.39
125 0.46
126 0.53
127 0.61
128 0.66
129 0.67
130 0.69
131 0.7
132 0.73
133 0.68
134 0.64
135 0.58
136 0.5
137 0.43
138 0.32
139 0.25
140 0.17
141 0.13
142 0.09
143 0.08
144 0.06
145 0.07
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.09
152 0.1
153 0.08
154 0.08
155 0.08
156 0.12
157 0.15
158 0.18
159 0.18
160 0.19
161 0.21
162 0.2
163 0.21
164 0.18