Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HYQ0

Protein Details
Accession A0A094HYQ0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
192-213TWRVAKTVRRVEKKRKVRPDFEBasic
NLS Segment(s)
PositionSequence
202-207VEKKRK
Subcellular Location(s) plas 16, mito 4, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR045863  CorA_TM1_TM2  
IPR002523  MgTranspt_CorA/ZnTranspt_ZntB  
Gene Ontology GO:0016020  C:membrane  
GO:0046873  F:metal ion transmembrane transporter activity  
GO:0015693  P:magnesium ion transport  
Pfam View protein in Pfam  
PF01544  CorA  
Amino Acid Sequences MTVRGSTNISGERLLTLGQAKAETWRLKPINLVESIVQDEVCFIFLENGDWFKNICTEANRRKILEPFQVPDILSSKLCTELNGYFGCRSSLGDEGNLIGLSTWFRILTKRVVEPGEKKLYSGEAYLWYEMAFFALWSTPGTARVLCIGTPLEMRVRIEQELQTRPAFNPNDPFAMLRPILDEVVRACDDDTWRVAKTVRRVEKKRKVRPDFEELYDLARHARHLVEIETVAIETMERMIIQQNVNYELLRTGLDKTYQIQAGEYMAFQLQMMKSLRSRAQATLDRLNGEVALAYNTLASMDNRIMKSVTILAMVFLPATFVAGLFSTTFFSFAENDGWGFSSKFWIYWVVVIPLTAAIVSGWWLWLGESSNKPSLSQVSESKTQTQTQTQTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.15
6 0.15
7 0.15
8 0.18
9 0.26
10 0.28
11 0.27
12 0.36
13 0.37
14 0.37
15 0.42
16 0.43
17 0.42
18 0.39
19 0.39
20 0.31
21 0.31
22 0.32
23 0.27
24 0.22
25 0.15
26 0.14
27 0.12
28 0.12
29 0.09
30 0.07
31 0.09
32 0.09
33 0.11
34 0.12
35 0.14
36 0.14
37 0.14
38 0.15
39 0.13
40 0.16
41 0.15
42 0.17
43 0.21
44 0.3
45 0.4
46 0.49
47 0.52
48 0.52
49 0.55
50 0.58
51 0.59
52 0.58
53 0.54
54 0.47
55 0.46
56 0.46
57 0.42
58 0.38
59 0.33
60 0.25
61 0.2
62 0.18
63 0.15
64 0.17
65 0.17
66 0.15
67 0.17
68 0.15
69 0.19
70 0.19
71 0.2
72 0.17
73 0.18
74 0.18
75 0.15
76 0.15
77 0.13
78 0.15
79 0.14
80 0.14
81 0.13
82 0.13
83 0.13
84 0.12
85 0.1
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.07
93 0.09
94 0.12
95 0.18
96 0.21
97 0.23
98 0.26
99 0.29
100 0.34
101 0.36
102 0.42
103 0.44
104 0.4
105 0.38
106 0.35
107 0.34
108 0.3
109 0.26
110 0.2
111 0.15
112 0.17
113 0.17
114 0.16
115 0.13
116 0.12
117 0.11
118 0.1
119 0.06
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.07
126 0.07
127 0.08
128 0.1
129 0.09
130 0.09
131 0.11
132 0.11
133 0.09
134 0.1
135 0.09
136 0.09
137 0.1
138 0.1
139 0.1
140 0.11
141 0.12
142 0.13
143 0.14
144 0.14
145 0.16
146 0.18
147 0.22
148 0.24
149 0.25
150 0.24
151 0.23
152 0.23
153 0.29
154 0.27
155 0.23
156 0.25
157 0.24
158 0.24
159 0.23
160 0.24
161 0.17
162 0.18
163 0.17
164 0.12
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.06
171 0.1
172 0.1
173 0.09
174 0.08
175 0.1
176 0.1
177 0.11
178 0.13
179 0.11
180 0.11
181 0.12
182 0.14
183 0.15
184 0.22
185 0.3
186 0.37
187 0.44
188 0.51
189 0.62
190 0.7
191 0.78
192 0.8
193 0.82
194 0.81
195 0.8
196 0.78
197 0.76
198 0.69
199 0.61
200 0.54
201 0.43
202 0.38
203 0.3
204 0.24
205 0.17
206 0.13
207 0.11
208 0.1
209 0.1
210 0.08
211 0.09
212 0.1
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.07
219 0.05
220 0.04
221 0.03
222 0.03
223 0.03
224 0.03
225 0.04
226 0.05
227 0.09
228 0.09
229 0.1
230 0.11
231 0.14
232 0.15
233 0.14
234 0.13
235 0.1
236 0.1
237 0.1
238 0.1
239 0.09
240 0.1
241 0.11
242 0.12
243 0.13
244 0.16
245 0.17
246 0.17
247 0.15
248 0.14
249 0.14
250 0.14
251 0.12
252 0.09
253 0.07
254 0.07
255 0.07
256 0.09
257 0.08
258 0.13
259 0.15
260 0.16
261 0.17
262 0.22
263 0.25
264 0.26
265 0.29
266 0.26
267 0.32
268 0.37
269 0.41
270 0.43
271 0.41
272 0.38
273 0.36
274 0.33
275 0.26
276 0.19
277 0.14
278 0.08
279 0.07
280 0.06
281 0.06
282 0.05
283 0.05
284 0.06
285 0.07
286 0.07
287 0.08
288 0.11
289 0.16
290 0.17
291 0.18
292 0.18
293 0.16
294 0.18
295 0.18
296 0.15
297 0.12
298 0.11
299 0.11
300 0.11
301 0.11
302 0.09
303 0.06
304 0.06
305 0.05
306 0.05
307 0.05
308 0.04
309 0.05
310 0.05
311 0.06
312 0.06
313 0.07
314 0.08
315 0.09
316 0.1
317 0.09
318 0.1
319 0.1
320 0.12
321 0.13
322 0.12
323 0.12
324 0.12
325 0.13
326 0.13
327 0.12
328 0.11
329 0.15
330 0.15
331 0.15
332 0.15
333 0.18
334 0.17
335 0.2
336 0.22
337 0.19
338 0.19
339 0.18
340 0.18
341 0.14
342 0.13
343 0.1
344 0.07
345 0.04
346 0.04
347 0.06
348 0.05
349 0.05
350 0.05
351 0.06
352 0.06
353 0.08
354 0.11
355 0.17
356 0.21
357 0.27
358 0.33
359 0.33
360 0.34
361 0.34
362 0.36
363 0.35
364 0.35
365 0.36
366 0.36
367 0.43
368 0.46
369 0.5
370 0.49
371 0.48
372 0.48
373 0.5