Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5G973

Protein Details
Accession C5G973    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-33QRGREIQQDTWRRRRRRSSTGGWFCYCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTADREQRGREIQQDTWRRRRRRSSTGGWFCYCAGCESFQDENDDEDEDEYDNGTMTMTIMVMVIDDGDDDDDDDDGWWWWWWQRVEEVEVGSWQLARRRRLKDTALGNREGCCGNLCRRGDNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.67
4 0.73
5 0.74
6 0.78
7 0.83
8 0.83
9 0.83
10 0.83
11 0.82
12 0.84
13 0.86
14 0.83
15 0.73
16 0.65
17 0.55
18 0.47
19 0.37
20 0.28
21 0.19
22 0.14
23 0.13
24 0.17
25 0.18
26 0.17
27 0.2
28 0.19
29 0.18
30 0.18
31 0.18
32 0.12
33 0.11
34 0.11
35 0.08
36 0.08
37 0.07
38 0.06
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.07
68 0.12
69 0.13
70 0.14
71 0.17
72 0.19
73 0.21
74 0.22
75 0.22
76 0.17
77 0.16
78 0.15
79 0.12
80 0.11
81 0.1
82 0.14
83 0.2
84 0.26
85 0.34
86 0.4
87 0.47
88 0.53
89 0.56
90 0.59
91 0.63
92 0.67
93 0.64
94 0.63
95 0.57
96 0.51
97 0.49
98 0.42
99 0.32
100 0.24
101 0.23
102 0.26
103 0.33
104 0.33