Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GWV7

Protein Details
Accession A0A094GWV7    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-25STEQTVAKKRGRPRKNPLPETAAPHydrophilic
NLS Segment(s)
PositionSequence
9-18KKRGRPRKNP
52-58AKPRTRK
139-184KPSPSNKPVSHPRTPSKTSTPKPPAKTAAKTPTPKPAPPVKPPAPK
Subcellular Location(s) nucl 11, mito 9, cyto 4, plas 1, pero 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTEQTVAKKRGRPRKNPLPETAAPSSPAPAKTTTTRKTAAPKTTPAATEPAKPRTRKAKTPTPETPSPEVAMPITPIQPTAAAPAPSPIPESVEPSNQTTSVPPPSPRPTASATPQHRPSAILTAVRELSTKASPAPKPSPSNKPVSHPRTPSKTSTPKPPAKTAAKTPTPKPAPPVKPPAPKIPLGALNAQIVDNISKPAGARPLPGGQQQLPKGYKPVARKVTMTIVALPIAIVTSYVLWQRLVMGEEQKVLVRAPPAPAPVVDVDTKETGSESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.87
4 0.88
5 0.85
6 0.83
7 0.76
8 0.73
9 0.67
10 0.57
11 0.48
12 0.41
13 0.37
14 0.33
15 0.3
16 0.25
17 0.23
18 0.26
19 0.31
20 0.4
21 0.42
22 0.43
23 0.44
24 0.46
25 0.53
26 0.57
27 0.59
28 0.55
29 0.55
30 0.54
31 0.56
32 0.52
33 0.44
34 0.42
35 0.35
36 0.38
37 0.39
38 0.44
39 0.47
40 0.48
41 0.53
42 0.58
43 0.63
44 0.64
45 0.66
46 0.67
47 0.68
48 0.75
49 0.77
50 0.74
51 0.73
52 0.69
53 0.66
54 0.57
55 0.51
56 0.42
57 0.34
58 0.27
59 0.21
60 0.17
61 0.13
62 0.12
63 0.11
64 0.11
65 0.1
66 0.1
67 0.1
68 0.12
69 0.14
70 0.13
71 0.13
72 0.14
73 0.14
74 0.14
75 0.16
76 0.12
77 0.13
78 0.13
79 0.17
80 0.18
81 0.21
82 0.22
83 0.23
84 0.24
85 0.2
86 0.2
87 0.17
88 0.18
89 0.19
90 0.2
91 0.19
92 0.24
93 0.29
94 0.32
95 0.31
96 0.32
97 0.31
98 0.33
99 0.36
100 0.4
101 0.39
102 0.43
103 0.46
104 0.44
105 0.39
106 0.37
107 0.33
108 0.28
109 0.25
110 0.21
111 0.17
112 0.18
113 0.18
114 0.17
115 0.16
116 0.11
117 0.12
118 0.1
119 0.1
120 0.1
121 0.15
122 0.16
123 0.21
124 0.25
125 0.28
126 0.33
127 0.37
128 0.44
129 0.42
130 0.49
131 0.45
132 0.47
133 0.52
134 0.54
135 0.56
136 0.53
137 0.56
138 0.55
139 0.57
140 0.55
141 0.54
142 0.56
143 0.53
144 0.57
145 0.61
146 0.61
147 0.61
148 0.62
149 0.61
150 0.58
151 0.59
152 0.56
153 0.55
154 0.55
155 0.56
156 0.53
157 0.55
158 0.53
159 0.5
160 0.48
161 0.5
162 0.48
163 0.5
164 0.58
165 0.56
166 0.61
167 0.63
168 0.66
169 0.6
170 0.55
171 0.5
172 0.44
173 0.41
174 0.34
175 0.33
176 0.26
177 0.22
178 0.21
179 0.19
180 0.15
181 0.11
182 0.1
183 0.09
184 0.08
185 0.07
186 0.07
187 0.08
188 0.1
189 0.15
190 0.14
191 0.15
192 0.18
193 0.22
194 0.24
195 0.27
196 0.29
197 0.27
198 0.33
199 0.34
200 0.38
201 0.37
202 0.35
203 0.35
204 0.36
205 0.38
206 0.38
207 0.46
208 0.46
209 0.46
210 0.47
211 0.47
212 0.49
213 0.47
214 0.41
215 0.33
216 0.26
217 0.24
218 0.22
219 0.18
220 0.11
221 0.08
222 0.06
223 0.05
224 0.04
225 0.04
226 0.06
227 0.08
228 0.09
229 0.09
230 0.1
231 0.11
232 0.12
233 0.13
234 0.14
235 0.17
236 0.17
237 0.19
238 0.2
239 0.19
240 0.18
241 0.17
242 0.17
243 0.16
244 0.17
245 0.19
246 0.22
247 0.23
248 0.23
249 0.23
250 0.24
251 0.23
252 0.24
253 0.22
254 0.2
255 0.21
256 0.21
257 0.22
258 0.18