Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HLV7

Protein Details
Accession A0A094HLV7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-77QLHQHKSNKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
49-77KSNKMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MAYSNSGTVNEFMARPIACQFGASETLNYQPSLLTTTSSLLHHQLHQHKSNKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.15
5 0.13
6 0.13
7 0.13
8 0.12
9 0.15
10 0.15
11 0.14
12 0.13
13 0.15
14 0.16
15 0.16
16 0.13
17 0.1
18 0.09
19 0.11
20 0.1
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.12
29 0.13
30 0.19
31 0.26
32 0.3
33 0.37
34 0.42
35 0.45
36 0.51
37 0.58
38 0.61
39 0.6
40 0.65
41 0.68
42 0.74
43 0.8
44 0.85
45 0.87
46 0.89
47 0.94
48 0.95
49 0.95
50 0.95
51 0.96
52 0.96
53 0.97
54 0.97
55 0.98
56 0.97
57 0.97