Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HXX3

Protein Details
Accession A0A094HXX3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
36-58DPPFTRVPRGRPKKERVRREDARBasic
NLS Segment(s)
PositionSequence
43-63PRGRPKKERVRREDARAPRGR
Subcellular Location(s) cyto 13.5, cysk 9, cyto_nucl 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MDYIPPELTAKRWQEVYLAPLPPVDITGLTVGEPCDPPFTRVPRGRPKKERVRREDARAPRGRLETRDHGGLLPLGAVVATVPDPVQHRCGTCGEAGHNARRCRRPHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.33
4 0.31
5 0.28
6 0.25
7 0.24
8 0.24
9 0.2
10 0.19
11 0.13
12 0.07
13 0.07
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.13
23 0.13
24 0.16
25 0.21
26 0.25
27 0.32
28 0.36
29 0.44
30 0.5
31 0.6
32 0.67
33 0.7
34 0.76
35 0.78
36 0.83
37 0.85
38 0.82
39 0.82
40 0.77
41 0.76
42 0.76
43 0.71
44 0.72
45 0.67
46 0.61
47 0.55
48 0.54
49 0.48
50 0.43
51 0.42
52 0.38
53 0.35
54 0.34
55 0.31
56 0.26
57 0.25
58 0.21
59 0.15
60 0.09
61 0.06
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.06
71 0.09
72 0.11
73 0.15
74 0.17
75 0.18
76 0.2
77 0.23
78 0.23
79 0.22
80 0.22
81 0.21
82 0.28
83 0.31
84 0.37
85 0.42
86 0.47
87 0.54
88 0.59