Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179TVT6

Protein Details
Accession A0A179TVT6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-39EKPQRFEKPSDHRTRSRKKGNIBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.333, cyto_nucl 9.333, mito 6.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCQRSRNFDYGQHHGRTEKPQRFEKPSDHRTRSRKKGNIVWLSLGRNRFLLPWDSYMVSPGQFTYLNLSLNRVQICDRLLECIAIPGQDNPEKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.5
4 0.54
5 0.52
6 0.51
7 0.57
8 0.62
9 0.68
10 0.68
11 0.68
12 0.68
13 0.71
14 0.75
15 0.72
16 0.73
17 0.76
18 0.81
19 0.81
20 0.81
21 0.77
22 0.73
23 0.74
24 0.76
25 0.72
26 0.64
27 0.57
28 0.49
29 0.46
30 0.43
31 0.36
32 0.26
33 0.2
34 0.19
35 0.15
36 0.14
37 0.15
38 0.13
39 0.14
40 0.15
41 0.16
42 0.15
43 0.16
44 0.15
45 0.12
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.12
52 0.14
53 0.16
54 0.16
55 0.19
56 0.2
57 0.23
58 0.23
59 0.19
60 0.18
61 0.18
62 0.19
63 0.2
64 0.18
65 0.18
66 0.18
67 0.18
68 0.17
69 0.17
70 0.17
71 0.14
72 0.15
73 0.13
74 0.18
75 0.22