Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094GZP2

Protein Details
Accession A0A094GZP2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65PGPPRAAKRVAKERRKKAAEYBasic
NLS Segment(s)
PositionSequence
47-62PPRAAKRVAKERRKKA
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSTASDLSATTTITNGNNTSKKTPPVMLDKYLATPPSITEKLAFPGPPRAAKRVAKERRKKAAEYIEGWQAEWERMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.2
4 0.23
5 0.26
6 0.3
7 0.32
8 0.34
9 0.35
10 0.36
11 0.33
12 0.38
13 0.39
14 0.37
15 0.35
16 0.33
17 0.32
18 0.3
19 0.26
20 0.18
21 0.14
22 0.12
23 0.16
24 0.16
25 0.14
26 0.14
27 0.14
28 0.15
29 0.17
30 0.16
31 0.11
32 0.18
33 0.2
34 0.26
35 0.28
36 0.3
37 0.35
38 0.39
39 0.46
40 0.5
41 0.58
42 0.63
43 0.71
44 0.77
45 0.81
46 0.81
47 0.76
48 0.74
49 0.74
50 0.7
51 0.63
52 0.57
53 0.53
54 0.49
55 0.46
56 0.39
57 0.3