Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094K8Z6

Protein Details
Accession A0A094K8Z6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-41SPVAPRKRAAPKPKANTTAKHydrophilic
NLS Segment(s)
PositionSequence
23-107PVAPRKRAAPKPKANTTAKRAPKKAAAAGSKPVGVKKTTAAPKTGAAAAAVKAKVEKVKKVVEKKAAPAKKEKAPAAPKTVVAKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MARETRAATGNSRPRIFEAPPSPVAPRKRAAPKPKANTTAKRAPKKAAAAGSKPVGVKKTTAAPKTGAAAAAVKAKVEKVKKVVEKKAAPAKKEKAPAAPKTVVAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.44
4 0.44
5 0.4
6 0.38
7 0.39
8 0.4
9 0.39
10 0.41
11 0.44
12 0.39
13 0.37
14 0.39
15 0.47
16 0.54
17 0.61
18 0.65
19 0.7
20 0.75
21 0.8
22 0.8
23 0.77
24 0.75
25 0.72
26 0.71
27 0.71
28 0.7
29 0.64
30 0.59
31 0.57
32 0.54
33 0.5
34 0.47
35 0.42
36 0.36
37 0.36
38 0.34
39 0.3
40 0.27
41 0.24
42 0.19
43 0.15
44 0.14
45 0.13
46 0.19
47 0.24
48 0.25
49 0.26
50 0.25
51 0.26
52 0.27
53 0.26
54 0.18
55 0.13
56 0.12
57 0.11
58 0.14
59 0.13
60 0.11
61 0.11
62 0.12
63 0.18
64 0.2
65 0.24
66 0.25
67 0.34
68 0.42
69 0.5
70 0.57
71 0.6
72 0.61
73 0.65
74 0.7
75 0.67
76 0.62
77 0.63
78 0.62
79 0.6
80 0.64
81 0.59
82 0.59
83 0.62
84 0.65
85 0.64
86 0.6
87 0.57