Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5G8I8

Protein Details
Accession C5G8I8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41PAEAVKQQTRKKQKNSRSDEKRRLDGDHydrophilic
NLS Segment(s)
PositionSequence
24-36RKKQKNSRSDEKR
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
Amino Acid Sequences MMLKMGCDDGVRPAPAEAVKQQTRKKQKNSRSDEKRRLDGDEKGSQVKSRQVKTRQGKASSYFTGEDDVDQDRELMTGARVYLTKPGGGRGICPGCCVFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.21
5 0.25
6 0.31
7 0.38
8 0.44
9 0.51
10 0.61
11 0.68
12 0.75
13 0.76
14 0.8
15 0.83
16 0.86
17 0.88
18 0.87
19 0.89
20 0.89
21 0.84
22 0.81
23 0.72
24 0.68
25 0.61
26 0.55
27 0.5
28 0.44
29 0.4
30 0.36
31 0.35
32 0.3
33 0.28
34 0.29
35 0.29
36 0.28
37 0.35
38 0.39
39 0.48
40 0.55
41 0.62
42 0.62
43 0.6
44 0.59
45 0.55
46 0.54
47 0.45
48 0.4
49 0.32
50 0.25
51 0.24
52 0.21
53 0.17
54 0.13
55 0.14
56 0.12
57 0.11
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.08
67 0.08
68 0.09
69 0.14
70 0.15
71 0.17
72 0.16
73 0.19
74 0.23
75 0.23
76 0.23
77 0.27
78 0.32
79 0.3
80 0.32