Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CQM7

Protein Details
Accession Q6CQM7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-111WISSGTTKKPRGKKSRKSKKGKHAAKKSQKEIEBasic
NLS Segment(s)
PositionSequence
86-114KKPRGKKSRKSKKGKHAAKKSQKEIEKEK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0016020  C:membrane  
GO:0051087  F:protein-folding chaperone binding  
KEGG kla:KLLA0_D15939g  -  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MMKSFTRSSNLTRQSCEVRQDSVVSHQLVDSFPVAMDKLQEYAHACLVDLRRIHSLEDAYQSMTVRVSGIMIVTALVLWISSGTTKKPRGKKSRKSKKGKHAAKKSQKEIEKEKLKNMSEEETIKYVLDKFTNEYEEGLHKLLENYDSTSETMQYQRNFYNEMLLHLLLDLDGVHLGNLEGEKKEQVRLQRKAAIKKIQLELKKLDKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.56
4 0.49
5 0.42
6 0.4
7 0.39
8 0.35
9 0.34
10 0.35
11 0.28
12 0.26
13 0.23
14 0.22
15 0.21
16 0.21
17 0.15
18 0.1
19 0.09
20 0.1
21 0.1
22 0.09
23 0.1
24 0.09
25 0.1
26 0.1
27 0.12
28 0.14
29 0.15
30 0.18
31 0.16
32 0.15
33 0.18
34 0.2
35 0.22
36 0.2
37 0.21
38 0.22
39 0.23
40 0.23
41 0.21
42 0.21
43 0.19
44 0.21
45 0.2
46 0.17
47 0.17
48 0.17
49 0.15
50 0.13
51 0.11
52 0.08
53 0.07
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.04
69 0.05
70 0.07
71 0.14
72 0.21
73 0.29
74 0.37
75 0.47
76 0.58
77 0.68
78 0.76
79 0.81
80 0.86
81 0.89
82 0.92
83 0.92
84 0.91
85 0.91
86 0.91
87 0.9
88 0.89
89 0.89
90 0.89
91 0.87
92 0.82
93 0.78
94 0.73
95 0.68
96 0.64
97 0.63
98 0.62
99 0.56
100 0.55
101 0.54
102 0.5
103 0.47
104 0.42
105 0.35
106 0.28
107 0.28
108 0.25
109 0.19
110 0.19
111 0.17
112 0.15
113 0.13
114 0.12
115 0.11
116 0.11
117 0.11
118 0.14
119 0.16
120 0.15
121 0.15
122 0.15
123 0.15
124 0.16
125 0.15
126 0.12
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.11
133 0.11
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.16
140 0.2
141 0.2
142 0.22
143 0.24
144 0.25
145 0.27
146 0.25
147 0.28
148 0.23
149 0.24
150 0.24
151 0.21
152 0.2
153 0.17
154 0.17
155 0.09
156 0.09
157 0.06
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.06
166 0.08
167 0.08
168 0.1
169 0.14
170 0.15
171 0.19
172 0.21
173 0.31
174 0.4
175 0.45
176 0.51
177 0.55
178 0.61
179 0.67
180 0.73
181 0.72
182 0.69
183 0.69
184 0.7
185 0.71
186 0.68
187 0.64
188 0.63