Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GF73

Protein Details
Accession A0A094GF73   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
288-316DSASNISSSRHRRPKRRNERRTPALVEEEHydrophilic
NLS Segment(s)
PositionSequence
297-308RHRRPKRRNERR
Subcellular Location(s) mito 12, nucl 6, extr 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences PSRPIFSALLAGSASVPTTRAPTPAPKVRSEFIAKTTLAIQRLYRLPTAPRDPEAAIYLLHNPSLHHLLTTLSLINTAEWEILISGRFDGFLWSGADLDAAAMSSPSSDPNFPSPPSRGPTPSSAAPPSRGPTPAGRYPFSPPPLRNAFDTSPPPSRNPTPSAFPPPSIPGTPFQGGRHPVSSDEDAEIAVLAEIERDIYAGMEALEDAFEALHRKAEVVRQALRQRGAGLAMAAQSRRGGVGIGVRAATPGGESAAGGWGGGGGSGWQGEESESGSEWAEEEIAPDDSASNISSSRHRRPKRRNERRTPALVEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.08
3 0.08
4 0.08
5 0.12
6 0.12
7 0.15
8 0.18
9 0.26
10 0.35
11 0.43
12 0.46
13 0.48
14 0.53
15 0.52
16 0.55
17 0.53
18 0.47
19 0.42
20 0.44
21 0.38
22 0.33
23 0.37
24 0.34
25 0.3
26 0.29
27 0.26
28 0.26
29 0.31
30 0.32
31 0.29
32 0.28
33 0.3
34 0.36
35 0.43
36 0.41
37 0.39
38 0.39
39 0.38
40 0.37
41 0.35
42 0.28
43 0.2
44 0.18
45 0.2
46 0.17
47 0.17
48 0.15
49 0.13
50 0.16
51 0.19
52 0.18
53 0.14
54 0.14
55 0.13
56 0.14
57 0.15
58 0.12
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.06
85 0.06
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.06
94 0.07
95 0.08
96 0.1
97 0.15
98 0.18
99 0.18
100 0.22
101 0.23
102 0.26
103 0.29
104 0.31
105 0.29
106 0.29
107 0.31
108 0.32
109 0.31
110 0.3
111 0.3
112 0.29
113 0.28
114 0.27
115 0.25
116 0.23
117 0.22
118 0.21
119 0.21
120 0.26
121 0.29
122 0.3
123 0.29
124 0.29
125 0.33
126 0.36
127 0.36
128 0.35
129 0.3
130 0.34
131 0.37
132 0.37
133 0.34
134 0.34
135 0.31
136 0.29
137 0.32
138 0.29
139 0.3
140 0.31
141 0.31
142 0.3
143 0.31
144 0.31
145 0.32
146 0.3
147 0.28
148 0.3
149 0.36
150 0.33
151 0.31
152 0.28
153 0.27
154 0.27
155 0.23
156 0.22
157 0.15
158 0.18
159 0.19
160 0.19
161 0.17
162 0.2
163 0.22
164 0.23
165 0.23
166 0.19
167 0.19
168 0.21
169 0.21
170 0.17
171 0.15
172 0.13
173 0.12
174 0.11
175 0.1
176 0.06
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.05
199 0.06
200 0.07
201 0.07
202 0.08
203 0.1
204 0.14
205 0.19
206 0.22
207 0.26
208 0.32
209 0.36
210 0.41
211 0.41
212 0.37
213 0.32
214 0.28
215 0.25
216 0.19
217 0.14
218 0.1
219 0.1
220 0.11
221 0.1
222 0.1
223 0.09
224 0.09
225 0.09
226 0.08
227 0.07
228 0.06
229 0.11
230 0.11
231 0.12
232 0.12
233 0.12
234 0.12
235 0.12
236 0.1
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.07
244 0.07
245 0.06
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.03
252 0.03
253 0.04
254 0.04
255 0.04
256 0.04
257 0.05
258 0.06
259 0.07
260 0.08
261 0.08
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.08
268 0.07
269 0.08
270 0.09
271 0.1
272 0.1
273 0.1
274 0.09
275 0.09
276 0.1
277 0.1
278 0.09
279 0.08
280 0.11
281 0.19
282 0.27
283 0.37
284 0.47
285 0.57
286 0.67
287 0.77
288 0.87
289 0.9
290 0.93
291 0.94
292 0.95
293 0.96
294 0.94
295 0.92
296 0.87
297 0.82
298 0.78
299 0.68