Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HBS7

Protein Details
Accession A0A094HBS7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-128KVCFPLPKPTKKPRLTPLSGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013154  ADH-like_N  
IPR002328  ADH_Zn_CS  
IPR011032  GroES-like_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF08240  ADH_N  
PROSITE View protein in PROSITE  
PS00059  ADH_ZINC  
Amino Acid Sequences MAEAAAAAPQTFDIPATYKAAVYDAPGTMSTKIETLDTPTPGPGEVLVRLTHSGVCHSDLGVMTNSWKGLPFPTQPGQVGGHEGVGIIHKLGPAAGPSNVKVGDRVGIKVCFPLPKPTKKPRLTPLSGSPTPAAPAPPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.15
4 0.16
5 0.15
6 0.15
7 0.16
8 0.15
9 0.14
10 0.14
11 0.11
12 0.12
13 0.13
14 0.14
15 0.14
16 0.14
17 0.13
18 0.11
19 0.11
20 0.11
21 0.1
22 0.14
23 0.17
24 0.18
25 0.18
26 0.18
27 0.17
28 0.17
29 0.16
30 0.11
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.1
37 0.11
38 0.11
39 0.1
40 0.11
41 0.1
42 0.12
43 0.11
44 0.1
45 0.11
46 0.1
47 0.11
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.07
57 0.1
58 0.1
59 0.15
60 0.17
61 0.19
62 0.19
63 0.21
64 0.21
65 0.18
66 0.18
67 0.14
68 0.11
69 0.1
70 0.09
71 0.07
72 0.06
73 0.06
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.07
82 0.09
83 0.1
84 0.11
85 0.13
86 0.14
87 0.14
88 0.14
89 0.13
90 0.15
91 0.15
92 0.17
93 0.18
94 0.18
95 0.18
96 0.2
97 0.21
98 0.21
99 0.22
100 0.31
101 0.35
102 0.44
103 0.53
104 0.62
105 0.7
106 0.73
107 0.79
108 0.79
109 0.81
110 0.77
111 0.74
112 0.73
113 0.72
114 0.66
115 0.61
116 0.52
117 0.43
118 0.39
119 0.33
120 0.25