Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GHN2

Protein Details
Accession C5GHN2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-40VLQTIKAREHHHRLKKEKKKMFKQEKIDYDVBasic
NLS Segment(s)
PositionSequence
17-30REHHHRLKKEKKKM
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MSSLFKYSAVLQTIKAREHHHRLKKEKKKMFKQEKIDYDVTCERLKKKTKLAEKERIEILFRSQMHSMIQDIEKAALLSEHANLLITEVEFKTADQEMQDFEAQIDLAEEEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.35
4 0.4
5 0.49
6 0.57
7 0.59
8 0.65
9 0.73
10 0.8
11 0.86
12 0.88
13 0.87
14 0.88
15 0.89
16 0.9
17 0.91
18 0.89
19 0.89
20 0.87
21 0.84
22 0.8
23 0.72
24 0.6
25 0.55
26 0.48
27 0.41
28 0.34
29 0.31
30 0.27
31 0.32
32 0.39
33 0.38
34 0.43
35 0.48
36 0.55
37 0.63
38 0.69
39 0.71
40 0.67
41 0.66
42 0.6
43 0.52
44 0.44
45 0.34
46 0.28
47 0.23
48 0.2
49 0.19
50 0.17
51 0.17
52 0.17
53 0.17
54 0.15
55 0.12
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.08
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.06
74 0.08
75 0.08
76 0.1
77 0.09
78 0.1
79 0.12
80 0.12
81 0.13
82 0.11
83 0.12
84 0.12
85 0.15
86 0.16
87 0.13
88 0.13
89 0.13
90 0.12
91 0.11
92 0.1