Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094K6L2

Protein Details
Accession A0A094K6L2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-80NKASAPKKPIFRRTPRAPTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MGWLWSSAATPADAGAPTPQPQTTSTKQAAPPPTTPSQPLTPAQLAEQDLQAALAEFDAENKASAPKKPIFRRTPRAPTEGTPSSTTPDSELNVEDSLYPTTMSCRDAFDAAFYCQSLGGQFNAVYRYGGMQSCSDHWKSFWFCMRSKSYAGQREDMIKEHYRKKALKYKVGPSSEDVWEGREKKMEWGEAFSEGVEELLPGESDEEWNVRERKRREGRNGGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.15
5 0.18
6 0.18
7 0.18
8 0.21
9 0.27
10 0.29
11 0.34
12 0.35
13 0.39
14 0.42
15 0.48
16 0.53
17 0.5
18 0.48
19 0.47
20 0.48
21 0.44
22 0.44
23 0.4
24 0.36
25 0.36
26 0.34
27 0.33
28 0.31
29 0.29
30 0.27
31 0.27
32 0.25
33 0.21
34 0.2
35 0.14
36 0.13
37 0.12
38 0.11
39 0.07
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.11
50 0.13
51 0.15
52 0.2
53 0.25
54 0.34
55 0.42
56 0.52
57 0.57
58 0.65
59 0.72
60 0.76
61 0.8
62 0.76
63 0.72
64 0.64
65 0.57
66 0.55
67 0.49
68 0.42
69 0.34
70 0.3
71 0.28
72 0.27
73 0.25
74 0.18
75 0.16
76 0.14
77 0.12
78 0.12
79 0.11
80 0.11
81 0.11
82 0.09
83 0.09
84 0.09
85 0.08
86 0.07
87 0.06
88 0.07
89 0.08
90 0.1
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.1
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.1
120 0.12
121 0.16
122 0.17
123 0.16
124 0.15
125 0.2
126 0.21
127 0.24
128 0.3
129 0.29
130 0.3
131 0.36
132 0.4
133 0.38
134 0.38
135 0.41
136 0.42
137 0.46
138 0.47
139 0.43
140 0.39
141 0.42
142 0.41
143 0.36
144 0.34
145 0.32
146 0.35
147 0.4
148 0.44
149 0.46
150 0.48
151 0.55
152 0.59
153 0.61
154 0.65
155 0.64
156 0.68
157 0.69
158 0.69
159 0.62
160 0.56
161 0.53
162 0.44
163 0.4
164 0.31
165 0.25
166 0.29
167 0.29
168 0.27
169 0.27
170 0.27
171 0.3
172 0.35
173 0.37
174 0.31
175 0.34
176 0.34
177 0.31
178 0.3
179 0.23
180 0.19
181 0.13
182 0.12
183 0.08
184 0.06
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.07
191 0.08
192 0.09
193 0.1
194 0.11
195 0.18
196 0.23
197 0.27
198 0.36
199 0.38
200 0.48
201 0.57
202 0.66
203 0.7
204 0.77