Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U1P2

Protein Details
Accession A0A179U1P2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-39PQNQIHRGMLKKKMKKKKRDLKNPQDKMPSHBasic
NLS Segment(s)
PositionSequence
17-30MLKKKMKKKKRDLK
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MHVLLISSPQNQIHRGMLKKKMKKKKRDLKNPQDKMPSHPTQATKRSLLHADLLPLATIALPTNQHQPTPPSCSLPSVCSVSKYSTHLASHDPPADWTGLGWLVTSLQRTSGQRCMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.43
4 0.49
5 0.57
6 0.65
7 0.72
8 0.77
9 0.8
10 0.85
11 0.89
12 0.89
13 0.9
14 0.92
15 0.93
16 0.93
17 0.95
18 0.91
19 0.87
20 0.85
21 0.75
22 0.71
23 0.68
24 0.6
25 0.52
26 0.5
27 0.48
28 0.46
29 0.51
30 0.48
31 0.42
32 0.39
33 0.39
34 0.36
35 0.32
36 0.27
37 0.22
38 0.19
39 0.16
40 0.15
41 0.12
42 0.09
43 0.08
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.06
50 0.13
51 0.14
52 0.14
53 0.15
54 0.19
55 0.21
56 0.28
57 0.28
58 0.25
59 0.25
60 0.28
61 0.28
62 0.26
63 0.26
64 0.22
65 0.22
66 0.2
67 0.22
68 0.21
69 0.22
70 0.24
71 0.23
72 0.23
73 0.23
74 0.22
75 0.26
76 0.26
77 0.29
78 0.29
79 0.27
80 0.24
81 0.24
82 0.24
83 0.19
84 0.15
85 0.12
86 0.11
87 0.1
88 0.09
89 0.08
90 0.09
91 0.11
92 0.13
93 0.11
94 0.13
95 0.18
96 0.21
97 0.26