Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GRD6

Protein Details
Accession A0A094GRD6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-83ADIEKREWLREKRKRYRQRKRERDEADQGEBasic
NLS Segment(s)
PositionSequence
60-76EWLREKRKRYRQRKRER
Subcellular Location(s) nucl 17.5, cyto_nucl 11, pero 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MWDEELGIAEEKHWSAATYREKLGVENALEKASEANAVLAKKMLAIVDEEQRLADIEKREWLREKRKRYRQRKRERDEADQGELPKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.18
4 0.25
5 0.27
6 0.28
7 0.3
8 0.31
9 0.31
10 0.32
11 0.27
12 0.21
13 0.2
14 0.2
15 0.16
16 0.16
17 0.15
18 0.13
19 0.1
20 0.09
21 0.06
22 0.06
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.06
31 0.04
32 0.06
33 0.07
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.1
41 0.12
42 0.11
43 0.12
44 0.18
45 0.2
46 0.22
47 0.3
48 0.38
49 0.45
50 0.52
51 0.62
52 0.67
53 0.77
54 0.85
55 0.89
56 0.93
57 0.93
58 0.95
59 0.95
60 0.93
61 0.92
62 0.89
63 0.87
64 0.85
65 0.8
66 0.75
67 0.68