Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HS25

Protein Details
Accession A0A094HS25    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-79EPTRVAPPTPKSKPRRRIPRPSLQNQYIHydrophilic
NLS Segment(s)
PositionSequence
61-71PKSKPRRRIPR
Subcellular Location(s) cyto 12, nucl 7, mito 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MTAPFEVAPSRPSPAISAMATMAGAGAANVLETKGVDAVAKSEAPAAPAPTEPTRVAPPTPKSKPRRRIPRPSLQNQYIYAHPAPTLNSILAAEAARPVTAAEAEEVEIDWRLVAAAASKRGRNPSVTSNETALFTPAMSITSLASTLVDRASVHSSTTAAGSQAADRYGWEESLSARSSLELGSRASEETTRGFSRGDDMMAPPPVAAQERAHERGFMGKKGLLWKVLTMNTRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.21
4 0.21
5 0.17
6 0.17
7 0.16
8 0.13
9 0.1
10 0.06
11 0.05
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.08
26 0.1
27 0.1
28 0.09
29 0.12
30 0.11
31 0.13
32 0.15
33 0.15
34 0.14
35 0.14
36 0.19
37 0.18
38 0.21
39 0.19
40 0.21
41 0.23
42 0.24
43 0.26
44 0.29
45 0.34
46 0.4
47 0.47
48 0.55
49 0.61
50 0.69
51 0.77
52 0.8
53 0.85
54 0.86
55 0.89
56 0.88
57 0.89
58 0.89
59 0.87
60 0.86
61 0.78
62 0.72
63 0.62
64 0.56
65 0.46
66 0.4
67 0.32
68 0.23
69 0.19
70 0.16
71 0.15
72 0.15
73 0.15
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.05
103 0.06
104 0.11
105 0.13
106 0.14
107 0.16
108 0.19
109 0.21
110 0.21
111 0.22
112 0.25
113 0.3
114 0.32
115 0.31
116 0.29
117 0.29
118 0.27
119 0.25
120 0.18
121 0.12
122 0.09
123 0.08
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.07
139 0.1
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.12
146 0.1
147 0.07
148 0.07
149 0.07
150 0.08
151 0.09
152 0.09
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.09
161 0.13
162 0.14
163 0.12
164 0.12
165 0.12
166 0.12
167 0.12
168 0.13
169 0.1
170 0.1
171 0.11
172 0.12
173 0.12
174 0.12
175 0.13
176 0.13
177 0.13
178 0.18
179 0.17
180 0.18
181 0.18
182 0.17
183 0.2
184 0.19
185 0.18
186 0.15
187 0.16
188 0.19
189 0.2
190 0.2
191 0.16
192 0.15
193 0.16
194 0.17
195 0.17
196 0.14
197 0.19
198 0.26
199 0.31
200 0.31
201 0.3
202 0.28
203 0.36
204 0.38
205 0.34
206 0.31
207 0.28
208 0.31
209 0.37
210 0.4
211 0.34
212 0.32
213 0.32
214 0.35
215 0.39
216 0.39