Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094K577

Protein Details
Accession A0A094K577   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-87LRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVBasic
NLS Segment(s)
PositionSequence
51-78SLRGGAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MLSISNQVVWLTLTEPKLYAIRRPDQRISSPTHLRPLRKTIRLSRQSCKSSLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDNENKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.21
5 0.21
6 0.25
7 0.28
8 0.36
9 0.43
10 0.5
11 0.54
12 0.55
13 0.59
14 0.58
15 0.58
16 0.57
17 0.57
18 0.53
19 0.56
20 0.56
21 0.54
22 0.55
23 0.57
24 0.57
25 0.56
26 0.59
27 0.59
28 0.65
29 0.71
30 0.71
31 0.69
32 0.7
33 0.66
34 0.63
35 0.58
36 0.5
37 0.44
38 0.46
39 0.48
40 0.46
41 0.51
42 0.59
43 0.65
44 0.71
45 0.75
46 0.78
47 0.74
48 0.75
49 0.77
50 0.78
51 0.79
52 0.81
53 0.83
54 0.83
55 0.89
56 0.9
57 0.91
58 0.9
59 0.9
60 0.91
61 0.91
62 0.93
63 0.92
64 0.92
65 0.9
66 0.88
67 0.86
68 0.81
69 0.75
70 0.66
71 0.57
72 0.47
73 0.39
74 0.33
75 0.24
76 0.24
77 0.21
78 0.23
79 0.27
80 0.3
81 0.31
82 0.33
83 0.36
84 0.34
85 0.38
86 0.4
87 0.39
88 0.41
89 0.42
90 0.39
91 0.36
92 0.32
93 0.27
94 0.21
95 0.17
96 0.11
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.1
104 0.14
105 0.17
106 0.18
107 0.24
108 0.29
109 0.28
110 0.32
111 0.34
112 0.36
113 0.38
114 0.42
115 0.43