Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094IWE9

Protein Details
Accession A0A094IWE9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-95ALSHSRTKRGEKKERGEKKESBasic
NLS Segment(s)
PositionSequence
80-105RTKRGEKKERGEKKESGEKKESGEKK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, pero 4, mito 2
Family & Domain DBs
Amino Acid Sequences MEPSSHACSEGERGEGERVDETDYPDEVDEEGISGDEGRCAHNPMDMEPSSPARARHETLPGALYTERQRTLLEALSHSRTKRGEKKERGEKKESGEKKESGEKKECGEKKECVVTQLVVGAGAAEAQGVMSWEQPSHAELSWVQSPIDQNRLCDTYFTIRWVAKQRQNLLIPTRLIVAAVNPRHIRIHPERHNGQVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.18
5 0.17
6 0.2
7 0.2
8 0.21
9 0.21
10 0.2
11 0.2
12 0.18
13 0.18
14 0.14
15 0.14
16 0.1
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.1
26 0.11
27 0.14
28 0.14
29 0.16
30 0.16
31 0.16
32 0.23
33 0.2
34 0.21
35 0.2
36 0.22
37 0.23
38 0.24
39 0.24
40 0.23
41 0.27
42 0.28
43 0.29
44 0.32
45 0.3
46 0.29
47 0.29
48 0.23
49 0.21
50 0.19
51 0.18
52 0.17
53 0.2
54 0.19
55 0.18
56 0.18
57 0.18
58 0.2
59 0.21
60 0.18
61 0.16
62 0.19
63 0.22
64 0.24
65 0.23
66 0.25
67 0.23
68 0.3
69 0.37
70 0.44
71 0.51
72 0.57
73 0.67
74 0.74
75 0.82
76 0.81
77 0.78
78 0.71
79 0.66
80 0.67
81 0.62
82 0.57
83 0.52
84 0.46
85 0.43
86 0.48
87 0.46
88 0.42
89 0.43
90 0.38
91 0.36
92 0.44
93 0.44
94 0.4
95 0.4
96 0.36
97 0.34
98 0.39
99 0.36
100 0.29
101 0.27
102 0.23
103 0.19
104 0.18
105 0.14
106 0.08
107 0.07
108 0.05
109 0.04
110 0.04
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.08
124 0.09
125 0.09
126 0.09
127 0.09
128 0.14
129 0.16
130 0.16
131 0.15
132 0.15
133 0.18
134 0.2
135 0.28
136 0.25
137 0.23
138 0.27
139 0.29
140 0.27
141 0.25
142 0.25
143 0.24
144 0.24
145 0.25
146 0.25
147 0.24
148 0.29
149 0.37
150 0.43
151 0.43
152 0.49
153 0.52
154 0.56
155 0.59
156 0.6
157 0.56
158 0.52
159 0.47
160 0.4
161 0.36
162 0.28
163 0.24
164 0.19
165 0.18
166 0.21
167 0.22
168 0.29
169 0.28
170 0.3
171 0.33
172 0.34
173 0.39
174 0.39
175 0.48
176 0.51
177 0.6
178 0.62
179 0.69