Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CKN9

Protein Details
Accession Q6CKN9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-110PVQRTPKQAKFGKRKSKANNIKCSYCHydrophilic
NLS Segment(s)
PositionSequence
96-99GKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG kla:KLLA0_F09229g  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MADADKIIKQSEALDQLAKLVLSQSQKKQSTLPSLKEEYENKLKNVDELISMITSVELDKEKFSKMISKQIEIIQKDGQEYALIPVQRTPKQAKFGKRKSKANNIKCSYCNETGHLRSKCEKKLLGVPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.21
5 0.18
6 0.13
7 0.1
8 0.12
9 0.17
10 0.23
11 0.29
12 0.37
13 0.4
14 0.41
15 0.44
16 0.46
17 0.51
18 0.52
19 0.5
20 0.47
21 0.48
22 0.48
23 0.49
24 0.45
25 0.41
26 0.44
27 0.41
28 0.35
29 0.36
30 0.34
31 0.3
32 0.29
33 0.24
34 0.14
35 0.12
36 0.12
37 0.09
38 0.09
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.08
48 0.08
49 0.09
50 0.09
51 0.15
52 0.16
53 0.24
54 0.25
55 0.25
56 0.27
57 0.31
58 0.36
59 0.3
60 0.31
61 0.24
62 0.23
63 0.23
64 0.21
65 0.16
66 0.11
67 0.1
68 0.09
69 0.11
70 0.1
71 0.1
72 0.13
73 0.19
74 0.21
75 0.26
76 0.3
77 0.32
78 0.41
79 0.48
80 0.54
81 0.6
82 0.68
83 0.75
84 0.77
85 0.81
86 0.81
87 0.86
88 0.87
89 0.86
90 0.86
91 0.81
92 0.79
93 0.71
94 0.69
95 0.65
96 0.6
97 0.52
98 0.45
99 0.46
100 0.47
101 0.54
102 0.51
103 0.48
104 0.51
105 0.57
106 0.6
107 0.6
108 0.56
109 0.52