FuNGI

A0A094H998

Protein Details

Accession

A0A094H998

Localization Confidence

Medium

Confidence Score

12.9

NoLS Segment(s)

Position	Sequence	Protein Nature
14-36	VWDASPKPTPRRSLNRAPRDTSP	Hydrophilic

NLS Segment(s)

Position	Sequence
56-64	RSRFDKRKG

Subcellular Location(s)

nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR027786 Nse4/EID IPR014854 Nse4_C IPR029225 Nse4_Nse3-bd
Gene Ontology	GO:0005634 C:nucleus GO:0030915 C:Smc5-Smc6 complex GO:0006310 P:DNA recombination GO:0006281 P:DNA repair
Pfam	View protein in Pfam PF15412 Nse4-Nse3_bdg PF08743 Nse4_C

Amino Acid Sequences

MPSKSRAPTYSEDVWDASPKPTPRRSLNRAPRDTSPSSSPHSAASQSSDKENKAARSRFDKRKGPEGMAAPPVSRGLSEISNGRNVKRKAVEVRDGDRSRSVRRRTREPENGSPVSQNGDDSSDNYDPDQDLQERRELRARFRNLEKDLNNNRAEFLHADNEGLKQTLLEADNILNGVKQTGDATVDSRLIANAADLSLKKIEKLTLGDTDRRVDIDHFVAKCMTFMRNGQGSAPSRAPTSTQSRRRTMQNGDNPDDDDDPEAGDMLDWSHLGAFACQQHNTRPPIPGFLLGPLSLEKRARRVIQRRAPNANRDLVETQPEILRPEDIERSENSSLTFLCARIMERLRQASAAGMDACEAEAWEGITDEEVKMLMRRHGLNADGGMDLFRFVINPRSFGQTVENMFYVSFLIRDGKAAITVDEDGLPFLGEAEPLGRAEALKKDVSKHQAIFAIDMATWEELIEVFEIREPIIEHREEVVQRAVGARGWYS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.38
3	0.34
4	0.29
5	0.29
6	0.32
7	0.38
8	0.44
9	0.5
10	0.56
11	0.64
12	0.71
13	0.76
14	0.8
15	0.83
16	0.84
17	0.81
18	0.77
19	0.75
20	0.71
21	0.64
22	0.59
23	0.52
24	0.5
25	0.49
26	0.43
27	0.38
28	0.36
29	0.33
30	0.3
31	0.31
32	0.31
33	0.29
34	0.36
35	0.38
36	0.36
37	0.39
38	0.43
39	0.45
40	0.49
41	0.52
42	0.52
43	0.57
44	0.66
45	0.71
46	0.75
47	0.76
48	0.72
49	0.77
50	0.75
51	0.69
52	0.66
53	0.59
54	0.55
55	0.52
56	0.47
57	0.38
58	0.33
59	0.3
60	0.23
61	0.19
62	0.15
63	0.12
64	0.12
65	0.14
66	0.17
67	0.18
68	0.26
69	0.28
70	0.3
71	0.36
72	0.36
73	0.42
74	0.42
75	0.47
76	0.48
77	0.55
78	0.6
79	0.58
80	0.61
81	0.64
82	0.61
83	0.56
84	0.54
85	0.49
86	0.5
87	0.52
88	0.57
89	0.55
90	0.61
91	0.69
92	0.7
93	0.77
94	0.78
95	0.78
96	0.78
97	0.78
98	0.74
99	0.64
100	0.58
101	0.48
102	0.41
103	0.32
104	0.23
105	0.15
106	0.16
107	0.15
108	0.15
109	0.2
110	0.18
111	0.18
112	0.17
113	0.18
114	0.15
115	0.16
116	0.18
117	0.16
118	0.18
119	0.19
120	0.26
121	0.26
122	0.28
123	0.34
124	0.32
125	0.37
126	0.44
127	0.48
128	0.49
129	0.54
130	0.6
131	0.58
132	0.64
133	0.58
134	0.58
135	0.59
136	0.6
137	0.55
138	0.46
139	0.43
140	0.34
141	0.34
142	0.26
143	0.21
144	0.17
145	0.15
146	0.15
147	0.15
148	0.16
149	0.14
150	0.13
151	0.1
152	0.07
153	0.07
154	0.1
155	0.1
156	0.09
157	0.09
158	0.09
159	0.09
160	0.1
161	0.09
162	0.06
163	0.06
164	0.05
165	0.05
166	0.05
167	0.05
168	0.05
169	0.06
170	0.07
171	0.08
172	0.09
173	0.09
174	0.09
175	0.09
176	0.08
177	0.07
178	0.07
179	0.06
180	0.04
181	0.04
182	0.06
183	0.06
184	0.07
185	0.1
186	0.1
187	0.1
188	0.11
189	0.12
190	0.12
191	0.14
192	0.15
193	0.19
194	0.21
195	0.24
196	0.25
197	0.25
198	0.24
199	0.22
200	0.2
201	0.15
202	0.14
203	0.14
204	0.17
205	0.16
206	0.16
207	0.16
208	0.15
209	0.15
210	0.15
211	0.12
212	0.09
213	0.1
214	0.13
215	0.15
216	0.15
217	0.15
218	0.19
219	0.2
220	0.22
221	0.22
222	0.19
223	0.17
224	0.17
225	0.18
226	0.17
227	0.23
228	0.3
229	0.38
230	0.43
231	0.47
232	0.5
233	0.53
234	0.54
235	0.52
236	0.52
237	0.5
238	0.51
239	0.5
240	0.48
241	0.44
242	0.4
243	0.34
244	0.25
245	0.18
246	0.11
247	0.09
248	0.08
249	0.07
250	0.05
251	0.04
252	0.04
253	0.03
254	0.03
255	0.03
256	0.03
257	0.03
258	0.04
259	0.04
260	0.05
261	0.06
262	0.1
263	0.12
264	0.13
265	0.14
266	0.18
267	0.24
268	0.28
269	0.28
270	0.28
271	0.27
272	0.29
273	0.29
274	0.27
275	0.21
276	0.18
277	0.17
278	0.13
279	0.13
280	0.11
281	0.11
282	0.12
283	0.15
284	0.14
285	0.18
286	0.22
287	0.27
288	0.35
289	0.43
290	0.51
291	0.57
292	0.65
293	0.68
294	0.73
295	0.73
296	0.7
297	0.65
298	0.59
299	0.51
300	0.46
301	0.41
302	0.32
303	0.31
304	0.24
305	0.21
306	0.17
307	0.18
308	0.15
309	0.14
310	0.13
311	0.11
312	0.13
313	0.16
314	0.16
315	0.17
316	0.17
317	0.23
318	0.23
319	0.23
320	0.2
321	0.18
322	0.17
323	0.17
324	0.17
325	0.11
326	0.11
327	0.11
328	0.12
329	0.17
330	0.2
331	0.21
332	0.25
333	0.27
334	0.27
335	0.27
336	0.26
337	0.21
338	0.19
339	0.17
340	0.12
341	0.09
342	0.09
343	0.09
344	0.08
345	0.07
346	0.06
347	0.04
348	0.04
349	0.05
350	0.04
351	0.05
352	0.05
353	0.05
354	0.06
355	0.06
356	0.06
357	0.06
358	0.06
359	0.09
360	0.11
361	0.13
362	0.17
363	0.18
364	0.21
365	0.23
366	0.24
367	0.23
368	0.21
369	0.2
370	0.16
371	0.14
372	0.12
373	0.1
374	0.09
375	0.07
376	0.06
377	0.05
378	0.06
379	0.16
380	0.16
381	0.19
382	0.2
383	0.27
384	0.27
385	0.28
386	0.31
387	0.28
388	0.29
389	0.29
390	0.28
391	0.22
392	0.21
393	0.2
394	0.17
395	0.11
396	0.09
397	0.07
398	0.1
399	0.1
400	0.11
401	0.12
402	0.11
403	0.13
404	0.14
405	0.13
406	0.12
407	0.13
408	0.13
409	0.12
410	0.12
411	0.1
412	0.1
413	0.09
414	0.07
415	0.07
416	0.06
417	0.05
418	0.06
419	0.06
420	0.07
421	0.07
422	0.08
423	0.07
424	0.08
425	0.11
426	0.16
427	0.19
428	0.22
429	0.24
430	0.28
431	0.35
432	0.42
433	0.46
434	0.43
435	0.44
436	0.44
437	0.43
438	0.41
439	0.34
440	0.29
441	0.21
442	0.2
443	0.17
444	0.12
445	0.11
446	0.09
447	0.08
448	0.07
449	0.08
450	0.08
451	0.07
452	0.07
453	0.09
454	0.1
455	0.1
456	0.11
457	0.12
458	0.16
459	0.21
460	0.22
461	0.21
462	0.23
463	0.3
464	0.29
465	0.31
466	0.3
467	0.25
468	0.25
469	0.25
470	0.24
471	0.2

A0A094H998

3D AlphaFold-predicted Structure Viewer