Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HAS9

Protein Details
Accession A0A094HAS9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VISSSKPTKNIKKTTQRSKPPKVRETSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MAASLKACSEPTRRVISSSKPTKNIKKTTQRSKPPKVRETSAQLQRFLDEEDADYKSLAIPGSESHHKTAKEERRKAINEAVAREY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.51
5 0.56
6 0.57
7 0.57
8 0.64
9 0.7
10 0.75
11 0.75
12 0.75
13 0.76
14 0.79
15 0.83
16 0.85
17 0.86
18 0.86
19 0.88
20 0.88
21 0.86
22 0.84
23 0.78
24 0.71
25 0.66
26 0.64
27 0.62
28 0.61
29 0.55
30 0.48
31 0.43
32 0.4
33 0.35
34 0.28
35 0.2
36 0.11
37 0.09
38 0.1
39 0.11
40 0.11
41 0.1
42 0.09
43 0.09
44 0.1
45 0.09
46 0.06
47 0.06
48 0.07
49 0.12
50 0.18
51 0.2
52 0.22
53 0.28
54 0.28
55 0.31
56 0.4
57 0.46
58 0.51
59 0.57
60 0.61
61 0.66
62 0.69
63 0.7
64 0.68
65 0.65
66 0.59