Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HYY2

Protein Details
Accession A0A094HYY2    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRGDAKPKRKAAPKPGIGKSBasic
NLS Segment(s)
PositionSequence
6-20AKPKRKAAPKPGIGK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
Amino Acid Sequences MSRGDAKPKRKAAPKPGIGKSVKEDTKIQEQHKPFVAEARRADQLAEAVKSSGKSVDPELHAEIEKLIPIEAPFAFSTLQLSNHKYTSEGYEYIAFTFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.77
4 0.77
5 0.7
6 0.63
7 0.58
8 0.56
9 0.49
10 0.43
11 0.41
12 0.37
13 0.45
14 0.48
15 0.46
16 0.45
17 0.45
18 0.46
19 0.48
20 0.45
21 0.35
22 0.36
23 0.36
24 0.34
25 0.33
26 0.33
27 0.29
28 0.27
29 0.27
30 0.2
31 0.18
32 0.15
33 0.13
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.07
41 0.08
42 0.09
43 0.13
44 0.14
45 0.16
46 0.17
47 0.17
48 0.17
49 0.16
50 0.14
51 0.11
52 0.1
53 0.08
54 0.07
55 0.06
56 0.06
57 0.08
58 0.07
59 0.1
60 0.09
61 0.1
62 0.11
63 0.1
64 0.13
65 0.12
66 0.17
67 0.18
68 0.22
69 0.24
70 0.25
71 0.25
72 0.24
73 0.24
74 0.26
75 0.27
76 0.23
77 0.23
78 0.25
79 0.25